Conserved Protein Domain Family
cit_ly_ligase

?
TIGR00124: cit_ly_ligase 
[citrate (pro-3S)-lyase] ligase
ATP is cleaved to AMP and pyrophosphate during the reaction. The carboxyl end is homologous to a number of cytidyltransferases that also release pyrophosphate. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129230
View PSSM: TIGR00124
Aligned: 4 rows
Threshold Bit Score: 518.607
Threshold Setting Gi: 2842394
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44462         3 FERIS-TEQK-KLSLIQTFLHQNALKLDEQIEYFVVGYNDnEQIVVCGGLAGNIIKCVAIDESLR-GSG-VALQLITELV 78  Haemophilus inf...
P45410         5 LKRVQlLKDKpRREAIDRFLRQHQLSLEADCEMAIIAEYQ-QRLVGCGAIAGNVLKCIAIDPSLQ-GEG-LSLKLLTELL 81  Klebsiella pneu...
PID:e1249928   1 MRRDW--QNFlMACGIKNFD-DSELN---PLDITIAVYEN-EEIIGTGSIAGDVIKYVAVQETTMsGHStLFNQLMTKLE 73  Leuconostoc mes...
WP_021569815   7 FTRVKrSENK-KMAEIAQFLHENDLSVDTTVEVFITVTRD-EKLIACGGIAGNIIKCVAISESVR-GEG-LALTLATELI 82  Escherichia coli
P44462        79 DLAYTLKRPHLFIYTKPEYATLFKSCGFYIISDANPYVVLLENSATRLQKQCSLWEKMRVDGNRIGSIVMNANPFTLGHR 158 Haemophilus inf...
P45410        82 TLAYELGRSELFLFTKPCNAALFSGAGFWPIAQAGDRAVLMENSRERLTRYCRQLAMYRQPGRKIGAIVMNANPFTLGHR 161 Klebsiella pneu...
PID:e1249928  74 NFMAVEGRFHQFVFTKPIYQKSFEYIGFKTLAECK-QGILLEKGLPDIKEYLSTIPRPKTPIDKVASVVINANPFTNGHR 152 Leuconostoc mes...
WP_021569815  83 NLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVMVLMENSATRLKRYAESLKKFRHPGNKIGCIVMNANPFTNGHR 162 Escherichia coli
P44462       159 YLIEQALQQCDHLHLFIVGEDASQFSYTERFEMIQQGIFDLSNITLHSGSDYIISRATFPNYFLKDQLITDESYFEIDLK 238 Haemophilus inf...
P45410       162 WLVEQAASQCDWLHLFVVKEDASCFSYHDRFKLIEQGITGIDKVTLHPGSAYLISRATFPGYFLKEQGVVDDCHSQIDLQ 241 Klebsiella pneu...
PID:e1249928 153 FLIEEASRNNELVYVFVLNQEASLFHTDERIALVKAGVQDLSNVIVVNGGAYIISYLTFPAYFLKHNDSAIDYQTTIDVR 232 Leuconostoc mes...
WP_021569815 163 YLIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEIDLK 242 Escherichia coli
P44462       239 LFRLHIAQALGITHRFVGTELNCPVTAEYNRQMHYWLMDAEmNAPKINVIEIPRKTASN--HIISASTVRKHLAEKNWAQ 316 Haemophilus inf...
P45410       242 LFRERLAPALQITHRFVGTEPLCPLTRNYNQRMKSLLEAPG-DAPPIEVVELARIEKNG--GPVSASRVRELYRQRNWQA 318 Klebsiella pneu...
PID:e1249928 233 LFKYKIASALGITSRYVGSEPLSHTTNLYNQKL---ISELN---PQIEVHVIQRKLAAGdlGVISARTVREAIDKGDEAV 306 Leuconostoc mes...
WP_021569815 243 IFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTiSAPPIELVEIERLRYQE--MPISASRVRQLLAKNDLTA 320 Escherichia coli
P44462       317 LAEFVPMTTLNYLQKCGRF 335 Haemophilus influenzae Rd KW20
P45410       319 VAALVPPGTLSFLMQLAES 337 Klebsiella pneumoniae
PID:e1249928 307 WQKMVTETTQHFISNNLLE 325 Leuconostoc mesenteroides
WP_021569815 321 IAPLVPAVTLHYLQNLLEH 339 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap