Conserved Protein Domain Family
ArgJ

?
TIGR00120: ArgJ 
glutamate N-acetyltransferase/amino-acid acetyltransferase
This enzyme can acetylate Glu to N-acetyl-Glu by deacetylating N-2-acetyl-ornithine into ornithine; the two halves of this reaction represent the first and fifth steps in the synthesis of Arg (or citrulline) from Glu by way of ornithine (EC 2.3.1.35). In Bacillus stearothermophilus, but not in Thermus thermophilus HB27, the enzyme is bifunctional and can also use acetyl-CoA to acetylate Glu (EC 2.3.1.1). [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 161718
View PSSM: TIGR00120
Aligned: 6 rows
Threshold Bit Score: 600.648
Threshold Setting Gi: 499181103
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q04728        22 VPKTGSFPKGFEVGYTASGVkkngsLDLGVILNTnksRPSTAAAVFTTNKFKAAPVLTSKKVLETARgkNINAIVVNSGC 101 Saccharomyces c...
Q57645         4 IDGGVTAPKGFKANGYKEGK-----FGVAIIISE---KDAVGAGTFTTNKVVAHPVVLSRELIKNRD--KFRAIVANSGN 73  Methanocaldococ...
P36843        12 VTGDVSSPKGFQAKGVHCGLry-skKDLGVIISE---TPAVSAAVYTQSHFQAAPIKVTQDSLKHGP--TLKAVIVNSAI 85  Bacillus subtil...
WP_010872831  13 IEGNITAPKGFKAAGITAGLkpsgsPDLSLIYSE---TEAIAAGVFTTSQVRAACVDYCRQRLQAKA--SARAILVNSGQ 87  Synechocystis s...
WP_010875821   9 IRGGVCAVDGVLAAGCREGK-----YGVGLIIN----RGSTAAAVFTSNRVRAEPVKLTERVIADG---SISAIVANSGN 76  Methanothermoba...
WP_010878643   1 --MEITDIGGVLCNGIKEGK-----YGLGLVRV----RG-SIAGVFTQNKIRAAPVIVCEENIRDG---VVEGVIVNSGN 65  Archaeoglobus f...
Q04728       102 ANSVTgDLGMKDAQVMIDLVNDKIGQK-NSTLVMSTGVIGQRLQMDKISTGINKIFGEEKFGsdfNSWLNVAKSICTTDT 180 Saccharomyces c...
Q57645        74 ANCFT-KDGMEDAKEMQRLVAELFNINeDEVLVASTGVIGRKMDMNIIKDRINKVYNLIKEG---NSSINAAKAIMTTDT 149 Methanocaldococ...
P36843        86 ANACTgEQGLKDAYTMRESFASQLGIEpELVAVSSTGVIGEHLDMEKIHAGIELLKETPAGS----G-D-FEEAILTTDT 159 Bacillus subtil...
WP_010872831  88 ANAGTgKQGWDDAVESAQLLAQGLNISpESILLASTGVIGQRIKMEQLRQGITPLIQSLAP----NGGDKAARAIMTTDL 163 Synechocystis s...
WP_010875821  77 ANCFTgREGMDDARRMARKVAESLSMDeSEVAVASTGVIGRRMPIDKIEFLIQSAAAQLENSe--AASGALAEAIMTTDT 154 Methanothermoba...
WP_010878643  66 ANAYTgEQGMRDAREMCRIAANLLGCEeRRVAVASTGVIGRKLDMEWIRKKAPEVYSGLGNSv--ENAERFGRAIVTTDR 143 Archaeoglobus f...
Q04728       181 FPKLVTSRFKLPsGTEYTLTGMAKGAGMICPNM--ATLLGFIVTDLPIESKALQKMLTFATTRSFNCISVDGDMSTNDTI 258 Saccharomyces c...
Q57645       150 KPKEIAVEFEVN-GKTVRVGGIAKGAGMIAPNMlhATMLCFITTDIEIDKESLTNILQKVVDKTFNNISVDGDTSTNDTV 228 Methanocaldococ...
P36843       160 VIKQTCYELAIG-GKTVTIGGAAKGSGMIHPNM--ATMLGFVTTDAAIEEKALQKALREITDVSFNQITVDGETSTNDMV 236 Bacillus subtil...
WP_010872831 164 VPKTIALETEID-GRPVRMGGIAKGSGMIHPNM--ATMLAFVTCDAAVSTALWQQMLSRATQKTFNQVTVDGDTSTNDSL 240 Synechocystis s...
WP_010875821 155 FPKEVAVEFELEtGEKARIGAVAKGSGMIAPNM--ATMLSFITTDVDASSSELTEALRVAVDESFNMLIVDGDESTNDMV 232 Methanothermoba...
WP_010878643 144 FVKK--A--Y---SEKARIAAVAKGAGMIAPNM--ATMLCFAFTSAKFDSGELYDMLRRAADKTFNRLTVDGDTSTNDTV 214 Archaeoglobus f...
Q04728       259 CMLANGAIDTKEInedsKDFEQVKLQVTEFAQRLAQLVVRDGEGSTKFVTVNVKNALHFEDAKIIAESISNSMLVKTALY 338 Saccharomyces c...
Q57645       229 FVLANGLSGVNYE----ECGEEFENALLYVCRELAKMIVKDGEGATKFMEVVVKGAKTEEDAVKASKAIVNSLLVKTAVF 304 Methanocaldococ...
P36843       237 LVMANGCAENECLtedhPDWPVFKKALLLTCEDLAKEIARDGEGATKLIEAQVQGAKNNLDANVIAKKIVGSNLVKTAVY 316 Bacillus subtil...
WP_010872831 241 FALANGESRTAAItemgPNAEKLEAMLTAVCQHLAKAIARDGEGATCLMEIQVTGAPDDQSARAVARTIAGSSLVKSAVF 320 Synechocystis s...
WP_010875821 233 IISSTRTSGR--------IDSNFREALVAVCRELARMMARDGEGVTKSFQVDVVNAGTHEDAKMAARAIAGSSLVKTAIF 304 Methanothermoba...
WP_010878643 215 LLISTGKERV--------ERDVFEEELCSVFYSIAKQMARDGEGATKVFEVRVDGARNDEDANLIARAVASSLLVKTAIF 286 Archaeoglobus f...
Q04728       339 GQDANWGRILCAIGYAklndlkSLDVNKINVSFIATDNSEprELKLVANGVPqLEID--E-------T----RASEILA- 404 Saccharomyces c...
Q57645       305 GGDPNWGRIVAAVGYS------GADFNPEVVDVILSNYKD--EVYLVKDGIP-LADEgtE-------El--kKAEEIMK- 365 Methanocaldococ...
P36843       317 GTDANWGRIIGAIGHS------AAQVTAEEVEVYLGG------QCLFKNNEP-QPFS----------Es---IA-KEYLe 369 Bacillus subtil...
WP_010872831 321 GRDPNWGRIAGAAGRA------GVKFDQNNLLIKLGN------YVLMDQGQP-LEFD--RpgasnylKq---AASGAYLe 382 Synechocystis s...
WP_010875821 305 GADPNWGRIVAAAGYS------GAEFDPEEISVTLESDSE--SVVIVDHGDI-LAFE--G-------TeeleTAERVMT- 365 Methanothermoba...
WP_010878643 287 GCDPNWGRIIAAAGYS------GADVD-ERITLSLSDGRD--EVFLIDSGRP-LGNEe--------------RARVLMEk 342 Archaeoglobus f...
Q04728       405 LNDLEVSVDLGTGDQAAQFWTCDLSHEYVTINGDYRS 441 Saccharomyces cerevisiae S288c
Q57645       366 SDEIKIVVDLKMGEFENVCYGCDLSYEYVRINAEYTT 402 Methanocaldococcus jannaschii DSM 2661
P36843       370 GDEITIVIKMAEGDGNGRAWGCDLTYDYIKINASYRT 406 Bacillus subtilis subsp. subtilis str. 168
WP_010872831 383 QDTVLIQVDLGTGSGQGTAWGCDLSYDYVRINADYTT 419 Synechocystis sp. PCC 6803
WP_010875821 366 SKEIRIIVDLAAGDESATAYGCDLTYDYVRINAEYTT 402 Methanothermobacter thermautotrophicus
WP_010878643 343 AEELVIRLRLEKGNGKGFAIGCDLTYDYVKLNAEYTT 379 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap