1L5J


Conserved Protein Domain Family
acnB

?
TIGR00117: acnB 
Click on image for an interactive view with Cn3D
aconitate hydratase 2
Aconitate hydratase (aconitase) is an enzyme of the TCA cycle. This model describes aconitase 2, AcnB, which has weak similarity to aconitase 1. It is found almost exclusively in the Proteobacteria. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 129223
View PSSM: TIGR00117
Aligned: 4 rows
Threshold Bit Score: 1617.29
Threshold Setting Gi: 21730658
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1L5J_A         1 MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFLLDLLTNRVPPGVDEAAYVKAGFLAAIAKGEAKSPL 80  Escherichia col...
P36683         1 MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFLLDLLTNRVPPGVDEAAYVKAGFLAAIAKGEAKSPL 80  Escherichia col...
WP_000974032   5 FLEDYKKSVSERGSEGIPPLPLNAKQVQAVVEILTKDPTN-AAFAKELLIHRVSPGVDEGAKVKAEFLAKLSQKKLECVH 83  Helicobacter py...
P74582         1 MLQAYRRHVADRQKLGIPPLPLNAQQTTELCELLKNPPEAEKEELMMLLRDRVPPGVDEAAYVKAGFLTAIAKGEVTCPL 80  Synechocystis s...
1L5J_A        81 LTPEKAIELLGTMQGGYNIHPLIDALD--DAKLAPIAAKALSHTLLMFDNFYDVEEKAKAgNEYAKQVMQSWADAEWFLN 158 Escherichia col...
P36683        81 LTPEKAIELLGTMQGGYNIHPLIDALD--DAKLAPIAAKALSHTLLMFDNFYDVEEKAKAgNEYAKQVMQSWADAEWFLN 158 Escherichia col...
WP_000974032  84 ISALEATTLLGTMLGGYNVEPLIMGLEsqDKNIAKESAKALKTTLLVYGSFDKIAAMSKT-NALAKEVLESWANAEWFLN 162 Helicobacter py...
P74582        81 ISGQGAVDLLGTMIGGYNVQSLIELLKskDTNIASAAATALSKTLLVFDAFNDVLHLSDT-NGYAKQVIDAWAEGAWFIN 159 Synechocystis s...
1L5J_A       159 RPALAEKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPdqpgvvgpikQIEALQQKGFPLAYVGD 238 Escherichia col...
P36683       159 RPALAEKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPdqpgvvgpikQIEALQQKGFPLAYVGD 238 Escherichia col...
WP_000974032 163 KEPLNECIEACVFKIDGETNTDDLSPASDAFTRSDIPLHAKAMLKNRIENYEQ----------RIKAIKTKGVPVAYVGD 232 Helicobacter py...
P74582       160 KPEVPERITVTVFKVPGETNTDDLSPAPHATTRPDIPLHALAMLEAKMPEGLG----------TIAELKQKGHPVAYVGD 229 Synechocystis s...
1L5J_A       239 VVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRN 318 Escherichia col...
P36683       239 VVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRN 318 Escherichia col...
WP_000974032 233 VVGTGSSRKSATNSIMWHFGKDIPFVPNKRSGGIVIGGVIAPIFFATCEDSGALPIVADVKDLKEGDLIKIYPYKGEITL 312 Helicobacter py...
P74582       230 VVGTGSSRKSAINSVLWHIGTDIPFVPNKRAGGYILGGKIAPIFFNTAEDSGALPIECDVNQLNTGDVITIYPREGKITN 309 Synechocystis s...
1L5J_A       319 HEtG-ELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKG 397 Escherichia col...
P36683       319 HE-TgELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKG 397 Escherichia col...
WP_000974032 313 ND---KVVSTFKLEPETLLDEVRASGRIPLIIGRGLTNKARKFLGLGESEAFKKPSAPKSDAKGYTLAQKIVGHACGVKG 389 Helicobacter py...
P74582       310 KA-G-ETITTFQLKPETILDEVRAGGRIPLLIGRALTDKTREALGLSPSPLFVRPTAPADTGKGFTLAQKMVGKACGVQG 387 Synechocystis s...
1L5J_A       398 IRPGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHHTLPDFIMNRGGVSLRPGDG 477 Escherichia col...
P36683       398 IRPGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHHTLPDFIMNRGGVSLRPGDG 477 Escherichia col...
WP_000974032 390 ILPGTYCEPKVTTVGSQDTTGAMTRDEVKELASLKFDAPFVLQSFCHTAAYPKPSDVSLHATLPGFITQRGGVALHPGDG 469 Helicobacter py...
P74582       388 IRPGTSCEPIMTTVGSQDTTGPMTRDELKELACLGFNADLTLQTFCHTAAYPKPVDIKTHKDLPDFFSTRGGVALRPGDG 467 Synechocystis s...
1L5J_A       478 VIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYA 557 Escherichia col...
P36683       478 VIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYA 557 Escherichia col...
WP_000974032 470 VIHTWLNRMGLPDTLGTGGDSHTRFPLGISFPAGSGLVAFAAVTGTMPLNMPESVLVRFKGEMNPGITLRDLVNAIPYYA 549 Helicobacter py...
P74582       468 IIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAAALGVMPLDMPESVLVKFTGELQPGVTLRDIVNAIPWVA 547 Synechocystis s...
1L5J_A       558 IKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGYGD 637 Escherichia col...
P36683       558 IKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGYGD 637 Escherichia col...
WP_000974032 550 IKKGLLTVEKKGKINVFNGRILEIEGLPDIKMEQAFELSDASAERSAAACVVRLNKEPMIEYLKSNIKLIDEMIASGYED 629 Helicobacter py...
P74582       548 MQQGKLTVGKGDKVNVFNGRIMEMEGLPDLKVEQAFELTDATAERSCSGSTIKLSEETVAEYLRSNVVLMKNMIARGYQD 627 Synechocystis s...
1L5J_A       638 RRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPLSAVQGE-------KIDEVFIGSC 710 Escherichia col...
P36683       638 RRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPLSAVQGE-------KIDEVFIGSC 710 Escherichia col...
WP_000974032 630 KETLKKRRDAMQAWVDNPVLLEPDSNAQYAAVIEIDVAEITEPILACPNDPDDVATLSEVLADttgkrphAIDEVFIGSC 709 Helicobacter py...
P74582       628 ARTLLRRIAKMEEWLANPSLMSGDADAEYADVIEVNLDEIKEPIVAAPNDPDNVKLMSECAGD-------VIHEVFIGSC 700 Synechocystis s...
1L5J_A       711 MTNIGHFRAAGKLLDAHkG-QLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTS 789 Escherichia col...
P36683       711 MTNIGHFRAAGKLLDAH-KgQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTS 789 Escherichia col...
WP_000974032 710 MTNIGHFRAFGEIVKNA-P-PSQARLWVVPPSKMDEQELINEGYYAIFGAAGARTEVPGCSLCMGNQARVRDNAVVFSTS 787 Helicobacter py...
P74582       701 MTNIGHYRAAAKILEGA-G-TVKGRLWICPPTRMDEQQLREEGIYGIFAAAGARTEMPGCSLCMGNQARVEDGVTVFSTS 778 Synechocystis s...
1L5J_A       790 TRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVD-TYRYLNFNQLSQYTE 854 Escherichia coli K-12
P36683       790 TRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVD-TYRYLNFNQLSQYTE 854 Escherichia coli K-12
WP_000974032 788 TRNFDNRMGRGAKVYLGSAELGAACALLGRIPTKEEYMNLVSEKLESQKDkIYRYMNFNLMENFRL 853 Helicobacter pylori
P74582       779 TRNFNNRMGKGAQVYLGSAELAAVCALLGKIPTVEEYLAIVSEKVAPFEGeLYRYLNFNEIDNFED 844 Synechocystis sp. PCC 6803 su...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap