1YQG


Conserved Protein Domain Family
proC

?
TIGR00112: proC 
Click on image for an interactive view with Cn3D
pyrroline-5-carboxylate reductase
This enzyme catalyzes the final step in proline biosynthesis. Among the four paralogs in Bacillus subtilis (proG, proH, proI, and comER), ComER is the most divergent and does not prevent proline auxotrophy from mutation of the other three. It is excluded from the seed and scores between the trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 272911
View PSSM: TIGR00112
Aligned: 25 rows
Threshold Bit Score: 215.971
Threshold Setting Gi: 499220842
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YQG_A        19 LVKQ------GG---YRIYIANRG-AE-KRERLEKELG----VETSATL------------PELHSD-DVLILAVKPQDX 70  Neisseria menin...
P32263        21 IYNapkaadetAaafYPSKIITCNhDE-PSAQQVTDLV----ETFDESPngikvestyghnVSAVEEaSVVLLGTKPFLA 95  Saccharomyces c...
AAK40815      25 IRLKy----------PSIHVIATArKD-ETLRNVKDLE----VETTKDn------------NYAVNKsDVIILSVKPQHF 77  Sulfolobus solf...
BAB60306      31 IPLKr----------SGFEVIVTRrNT-AVLKHLESYG----ISVMSDn------------KTASKEaDVVFLTLKPVDI 83  Thermoplasma vo...
O25773        20 AHEI-------LskrFILEITGRN-PE-KIAPFLQEKNiqaqIVPYKDA--------------IDIHqKFVFLLFKPYNL 76  Helicobacter py...
WP_000779749  19 IINS------SNldaNDIYLTNKS-NEqALKAFAEKLG----VNYSYDD------------ATLLKDaDYVFLGTKPHDF 75  Staphylococcus ...
WP_010906183  20 LDKN------KFk----IIISGHN-LT-KTQKQAETLN----VTATSNH------------EELVQEsDFIILSVKPQVL 71  Lactococcus lactis
WP_010880051  26 FSKK------LGk--ENIIVTDKV-QE-K-RNLATEMG----IAFASDV------------KFLADNsDVVLVAVKPKDS 78  Aquifex aeolicus
WP_002363318  19 ALKK------QFiaaENLYFYDIQ-VE-KTAAFAQEIG----AHAVASP------------QEAITVaDLVILAVKPQFV 74  Enterococcus fa...
WP_004081281  19 FSKE------AEr---iLLVEKDS-EK-LSRFNAPPYE----IADLEK----------------VREaDLIVLAVKPQDA 67  Thermotoga mari...
1YQG_A        71 EAACKNI----RTNgaLVLSVAAGLSVGTLSRYLgGT-R--RIVRVXPNTPGKIGLGVSGXYAEAEVSET-DRRIADRIX 142 Neisseria menin...
P32263        96 EEVLNgv--ksVIGgkLLISLAAGWTIDQLSQYTs------TVCRVMTNTPAKYGYGCAVVSYS-ADVSKeQKPLVNELI 166 Saccharomyces c...
AAK40815      78 PTVLR-QvgieSWRdkVVISIMAGVKLSTLSTLLn--nA--EVYRAMPNINAIVYKSTTTIAEN--NGKS--RELVENIF 148 Sulfolobus solf...
BAB60306      84 IPEVR-Kie-eNIRgkLLISMAAAIPLKLIKDAAp--hS--IVVRAMTNIAAKVGAGFTPFCVD--DGDQeVAKRASSIL 155 Thermoplasma vo...
O25773        77 KDFN--Yq----gQakSVLSALAGVGFKALSDAIdS--L--HYLKCMPNIASKFALSSTAVCEKSPM--PlISQKALSVI 144 Helicobacter py...
WP_000779749  76 DALATRIkp-hITKdnCFISIMAGIPIDYIKQQLeCQ-N--PVARIMPNTNAQVGHSVTGISFSNNFDPK-SKDEINDLV 150 Staphylococcus ...
WP_010906183  72 PSVLSKLin-hLTKdkTLISIAAGLTLSDLKHLAdSEnQ--PIIRVMPNINAQIGQSTSAIVKNEFVDDS-AYATVQEIF 147 Lactococcus lactis
WP_010880051  79 QEVLQKLk----DYkgIILSIMAGVSIEKMEKILgKD-K--KIVRVMPNVNVAVGSGVMAITDNGNLSEE-ERSKVEELL 150 Aquifex aeolicus
WP_002363318  75 QAALLEAkeaiLDKqpLIVSIAAGTTIAELYQLFeTT-QplRLVRVMPNMNALIGAGAAAVCGNAFASPE-DIQTVLSLF 152 Enterococcus fa...
WP_004081281  68 PIVLSALk----gFdgILLSIVAGLKIEEIRKY--GI-H--KVARIMPNVAVRVGEGVLATAFSADMSLE-ERELVKSLL 137 Thermotoga mari...
1YQG_A       143 KSVGLTVWLDdEEKXHGITGISGSGPAYVFYLLDALQNAAIRQGFDXAEARALSLATFKGAVALAeQTgE-DFEKLQKNV 221 Neisseria menin...
P32263       167 SQVGKYVELP-EKNMDAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVeKS-GaHPSVLKHQV 244 Saccharomyces c...
AAK40815     149 KTLGNVYWLP-EEYLDIWTALVGSGPAFISEIIDALSLGAVACGMQREIAYNAVLDMISGTIIMLkEGkIdHPMLLRDQV 227 Sulfolobus solf...
BAB60306     156 SALGEVYLVE-EKYMDALTALSGSGPAYILTIIEAMMYGGLKLGLPRDLALKASYQTVMGSAKLLaES-GeHPSELKEKV 233 Thermoplasma vo...
O25773       145 ESFGNCVRVGhEELVDASVATNGSALAFLSLVANSLKDAGIREGLNARGSLELVKMSFKGFAKLLeKE---RPEMIIEQI 221 Helicobacter py...
WP_000779749 151 KAFGSVIEVS-EDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGTSKMIeRSdL-SMAQLRKNI 228 Staphylococcus ...
WP_010906183 148 KSTGSVHEIA-EKDFSTFAAIAGSSPAFIYMFIDAMARAGVLHGIPKDQATAIVAETVRASAEMIlQSgE-NPWSLVDKV 225 Lactococcus lactis
WP_010880051 151 LSCGTLYRIE-ERLFDAFTALAGSGPAFVFSFIDALALAGVHQGFSYEQALRIALDTVMGSAKLLkEFqV-NPNELIAKV 228 Aquifex aeolicus
WP_002363318 153 RAVGQAWELE-EQYFSIFTAIAGSTPAYAFLFIDSIARAAVKNGMNKELALEIATQAVLGSAQTLaNStE-NPWTLIDQV 230 Enterococcus fa...
WP_004081281 138 EKLGFVVEIE-EKLFSAVTALTGSGPAFIFVVVEAFLDAALKMGIPLDTAKELVYRLFKGSAELLtETgE-HPALWKHRV 215 Thermotoga mari...
1YQG_A       222 TSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQE 257 Neisseria meningitidis MC58
P32263       245 CTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQ 280 Saccharomyces cerevisiae S288c
AAK40815     228 TTPVGTTIRGLMVMEAKSVKSALIETIEASYKRAVE 263 Sulfolobus solfataricus P2
BAB60306     234 ITPGGTTIDGIYELEDARVRTAIMKAIEVSTMKANK 269 Thermoplasma volcanium GSS1
O25773       222 CTPKGATIEGLSVLEKKGVRGAFIEACHKSVKKMRL 257 Helicobacter pylori 26695
WP_000779749 229 TSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDRSIE 264 Staphylococcus aureus
WP_010906183 226 SSPGGTTVAGVVSLEQNHFIGTVIDAISATIEKEKN 261 Lactococcus lactis
WP_010880051 229 TSPGGTTIEGIKYLEEKGFKGTVMECINRTSQKAKK 264 Aquifex aeolicus
WP_002363318 231 SSPGGTTVAGIVELENNAFISTVIKGIEATILRDQE 266 Enterococcus faecalis
WP_004081281 216 SSPAGTTIEGLITMERFAVRSGVIESLISSYRRALE 251 Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap