Conserved Protein Domain Family

TIGR00112: proC 
Click on image for an interactive view with Cn3D
pyrroline-5-carboxylate reductase
This enzyme catalyzes the final step in proline biosynthesis. Among the four paralogs in Bacillus subtilis (proG, proH, proI, and comER), ComER is the most divergent and does not prevent proline auxotrophy from mutation of the other three. It is excluded from the seed and scores between the trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family]
PSSM-Id: 272911
Aligned: 25 rows
Threshold Bit Score: 215.971
Threshold Setting Gi: 499220842
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1YQG_A        19 LVKQ------GG---YRIYIANRG-AE-KRERLEKELG----VETSATL------------PELHSD-DVLILAVKPQDX 70  Neisseria menin...
P32263        21 IYNapkaadetAaafYPSKIITCNhDE-PSAQQVTDLV----ETFDESPngikvestyghnVSAVEEaSVVLLGTKPFLA 95  Saccharomyces c...
AAK40815      25 IRLKy----------PSIHVIATArKD-ETLRNVKDLE----VETTKDn------------NYAVNKsDVIILSVKPQHF 77  Sulfolobus solf...
BAB60306      31 IPLKr----------SGFEVIVTRrNT-AVLKHLESYG----ISVMSDn------------KTASKEaDVVFLTLKPVDI 83  Thermoplasma vo...
O25773        20 AHEI-------LskrFILEITGRN-PE-KIAPFLQEKNiqaqIVPYKDA--------------IDIHqKFVFLLFKPYNL 76  Helicobacter py...
WP_000779749  19 IINS------SNldaNDIYLTNKS-NEqALKAFAEKLG----VNYSYDD------------ATLLKDaDYVFLGTKPHDF 75  Staphylococcus ...
WP_010906183  20 LDKN------KFk----IIISGHN-LT-KTQKQAETLN----VTATSNH------------EELVQEsDFIILSVKPQVL 71  Lactococcus lactis
WP_010880051  26 FSKK------LGk--ENIIVTDKV-QE-K-RNLATEMG----IAFASDV------------KFLADNsDVVLVAVKPKDS 78  Aquifex aeolicus
WP_002363318  19 ALKK------QFiaaENLYFYDIQ-VE-KTAAFAQEIG----AHAVASP------------QEAITVaDLVILAVKPQFV 74  Enterococcus fa...
WP_004081281  19 FSKE------AEr---iLLVEKDS-EK-LSRFNAPPYE----IADLEK----------------VREaDLIVLAVKPQDA 67  Thermotoga mari...
P32263       245 CTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQ 280 Saccharomyces cerevisiae S288c
AAK40815     228 TTPVGTTIRGLMVMEAKSVKSALIETIEASYKRAVE 263 Sulfolobus solfataricus P2
O25773       222 CTPKGATIEGLSVLEKKGVRGAFIEACHKSVKKMRL 257 Helicobacter pylori 26695
WP_000779749 229 TSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDRSIE 264 Staphylococcus aureus
WP_002363318 231 SSPGGTTVAGIVELENNAFISTVIKGIEATILRDQE 266 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap