Conserved Protein Domain Family
ilvD

?
TIGR00110: ilvD 
dihydroxy-acid dehydratase
This protein, dihydroxy-acid dehydratase, catalyzes the fourth step in valine and isoleucine biosynthesis. It contains a catalytically essential [4Fe-4S] cluster This model generates scores of up to 150 bits vs. 6-phosphogluconate dehydratase, a homologous enzyme. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 272910
Aligned: 8 rows
Threshold Bit Score: 897.93
Threshold Setting Gi: 6685559
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O29248        21 ALGVTDDEMDKPFIGVANAYNTIVPGHMTLDKLTQAVKEGVYAAGGVPFEFGIIGICDGIAMGHEGMCFSLPSRELVADT 100 Archaeoglobus f...
P44851        24 ATGMKENDFGKPIIAVVNSFTQFVPGHVHLKDMGQLVAAEIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADS 103 Haemophilus inf...
P74689        25 AVGFGDDDFTKPIVGIANGYSTITPCNMGINDLALRAEAGLRTAGAMPQLFGTITISDGISMGTEGMKYSLVSREVIADS 104 Synechocystis s...
P39522        45 ATGFKKEDFKKPQVGVGSCWWSGNPCNMHLLDLNNRCSQSIEKAGLKAMQFNTIGVSDGISMGTKGMRYSLQSREIIADS 124 Saccharomyces c...
AAA96629      24 AAGVKEEDFGKPFIAVCNSYIDIVPGHVHLQEFGKIVKEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADS 103 Bacillus subtil...
WP_010870789  29 ACGYTDEELERPFIGVVNSFTEVVPGHIHLRDIAEAVKKGIYANGGTAFEFNTMAICDGIAMGHEGMKYSLPSREIIADT 108 Methanocaldococ...
WP_001656088  24 ATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADS 103 Escherichia coli
O27498        21 rCGLTDDDFEKPFIGIANSYTDIVPGHIHLRELAEAVKEGVNAAGGVAFEFNTMAICDGIAMNHDGMKYSLASREIVADT 100 Methanothermoba...
P44851        24 ATGMKENDFGKPIIAVVNSFTQFVPGHVHLKDMGQLVAAEIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADS 103 Haemophilus inf...
P74689        25 AVGFGDDDFTKPIVGIANGYSTITPCNMGINDLALRAEAGLRTAGAMPQLFGTITISDGISMGTEGMKYSLVSREVIADS 104 Synechocystis s...
P39522        45 ATGFKKEDFKKPQVGVGSCWWSGNPCNMHLLDLNNRCSQSIEKAGLKAMQFNTIGVSDGISMGTKGMRYSLQSREIIADS 124 Saccharomyces c...
AAA96629      24 AAGVKEEDFGKPFIAVCNSYIDIVPGHVHLQEFGKIVKEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADS 103 Bacillus subtil...
WP_010870789  29 ACGYTDEELERPFIGVVNSFTEVVPGHIHLRDIAEAVKKGIYANGGTAFEFNTMAICDGIAMGHEGMKYSLPSREIIADT 108 Methanocaldococ...
WP_001656088  24 ATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADS 103 Escherichia coli
O27498        21 rCGLTDDDFEKPFIGIANSYTDIVPGHIHLRELAEAVKEGVNAAGGVAFEFNTMAICDGIAMNHDGMKYSLASREIVADT 100 Methanothermoba...
O29248       101 IEAMVEAHRFDGLVVVASCDKIIPGMLMAMLRLNIPAIAVTGGPMPYERVG------GEKVSIKDAFEAAGMYKAGKLDD 174 Archaeoglobus f...
P44851       104 VEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTKl-----SDQLIRLDLVDAMIEAADPNVSD 178 Haemophilus inf...
P74689       105 IETVCNGQRMDGVLAIGGCDKNMPGAMIAMARLNIPSIFVYGGTIKPGHYAg------EDLTVVSAFEAVGQYSAGKIDE 178 Synechocystis s...
P39522       125 FETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRPSIMVYGGTILPGHPTcgsskiSKNIDIVSAFQSYGEYISKQFTE 204 Saccharomyces c...
AAA96629     104 VETVVSAHWFDGMVCIPNCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTSy-----GRKISLSSVFEGVGAYQAGKINE 178 Bacillus subtil...
WP_010870789 109 VESMAKAHGFDGLVLIPSCDKIVPGMIMGAIRTGLPFIVVTGGPMFPGELR------GKKYDLISVFEGVGACAAGKITE 182 Methanocaldococ...
WP_001656088 104 VEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKl-----SDQIIKLDLVDAMIQGADPKVSD 178 Escherichia coli
O27498       101 VESMAMAHALDGLVLLPTCDKIVPGMLMAAARLDIPAIVVTGGPMLPGEFK------GRKVDLINVYEGVGTVSAGEMSE 174 Methanothermoba...
P44851       104 VEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTKl-----SDQLIRLDLVDAMIEAADPNVSD 178 Haemophilus inf...
P74689       105 IETVCNGQRMDGVLAIGGCDKNMPGAMIAMARLNIPSIFVYGGTIKPGHYAg------EDLTVVSAFEAVGQYSAGKIDE 178 Synechocystis s...
P39522       125 FETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRPSIMVYGGTILPGHPTcgsskiSKNIDIVSAFQSYGEYISKQFTE 204 Saccharomyces c...
AAA96629     104 VETVVSAHWFDGMVCIPNCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTSy-----GRKISLSSVFEGVGAYQAGKINE 178 Bacillus subtil...
WP_010870789 109 VESMAKAHGFDGLVLIPSCDKIVPGMIMGAIRTGLPFIVVTGGPMFPGELR------GKKYDLISVFEGVGACAAGKITE 182 Methanocaldococ...
WP_001656088 104 VEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKl-----SDQIIKLDLVDAMIQGADPKVSD 178 Escherichia coli
O27498       101 VESMAMAHALDGLVLLPTCDKIVPGMLMAAARLDIPAIVVTGGPMLPGEFK------GRKVDLINVYEGVGTVSAGEMSE 174 Methanothermoba...
O29248       175 AGLKLYEDYCAPYCGSCQGLYTANSMQILTETLGLSLPYCSTSPCPSSRKLRIAKQSGKRVVELVMQNIK-------PLD 247 Archaeoglobus f...
P44851       179 ERIDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEqddasvlPRS 258 Haemophilus inf...
P74689       179 ETLYGIERNACPGAGSCGGMFTANTMSSAFEAMGMSLPYSSTMAAVDGEKADSTEESAKVLVEAIKKQIL-------PSQ 251 Synechocystis s...
P39522       205 EEREDVVEHACPGPGSCGGMYTANTMASAAEVLGLTIPNSSSFPAVSKEKLAECDNIGEYIKKTMELGIL-------PRD 277 Saccharomyces c...
AAA96629     179 NELQELEQFGCPTCGSCSGMFTANSMNCLSEALGLALPGNGTILATSPERKEFVRKSAAQLMETIRKDIK-------PRD 251 Bacillus subtil...
WP_010870789 183 EELKEIEDIACPGAGSCAGLFTANTMACLTEAMGLSLPYCATSHATTAEKIRIAKRSGMRIVDLVRNNIT-------PDK 255 Methanocaldococ...
WP_001656088 179 SQSDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEqndesalPRN 258 Escherichia coli
O27498       175 DELEELERCACPGPRSCAGLFTANTMACLTEALGMSLPGCATAHAVSSRKRQIARLSGKRIVEMVQENLK-------PTM 247 Methanothermoba...
P44851       179 ERIDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIVELCKRYYEqddasvlPRS 258 Haemophilus inf...
P74689       179 ETLYGIERNACPGAGSCGGMFTANTMSSAFEAMGMSLPYSSTMAAVDGEKADSTEESAKVLVEAIKKQIL-------PSQ 251 Synechocystis s...
P39522       205 EEREDVVEHACPGPGSCGGMYTANTMASAAEVLGLTIPNSSSFPAVSKEKLAECDNIGEYIKKTMELGIL-------PRD 277 Saccharomyces c...
AAA96629     179 NELQELEQFGCPTCGSCSGMFTANSMNCLSEALGLALPGNGTILATSPERKEFVRKSAAQLMETIRKDIK-------PRD 251 Bacillus subtil...
WP_010870789 183 EELKEIEDIACPGAGSCAGLFTANTMACLTEAMGLSLPYCATSHATTAEKIRIAKRSGMRIVDLVRNNIT-------PDK 255 Methanocaldococ...
WP_001656088 179 SQSDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIVELTKRYYEqndesalPRN 258 Escherichia coli
O27498       175 DELEELERCACPGPRSCAGLFTANTMACLTEALGMSLPGCATAHAVSSRKRQIARLSGKRIVEMVQENLK-------PTM 247 Methanothermoba...
O29248       248 FVNERSFENAITMDMLVGGSTNTVLHLPAIAKEA-G-IRLSLDLFDEISRRTPHIVSIDPASKEM-VVDLDESGGVPMLI 324 Archaeoglobus f...
P44851       259 IGTFDAFENAMSLDIAMGGSSNTVLHLLAAAQEA-G-VDFKMEDIDRLSRKVPCLSKIAPNTNKYhMEDVHRAGGIMGLL 336 Haemophilus inf...
P74689       252 ILTRKAFENAIAVIMAVGGSTNAVLHLLAIANTI-G-VPLSLDDFETIRHKVPVLCDLKPSGKYV-TTNLHAAGGIPQVM 328 Synechocystis s...
P39522       278 ILTKEAFENAITYVVATGGSTNAVLHLVAVAHSA-G-VKLSPDDFQRISDTTPLIGDFKPSGKYV-MADLINVGGTQSVI 354 Saccharomyces c...
AAA96629     252 IVTVKAIDNAFALDMALGGSTNTVLHTLALANEA-G-VEYSLERINEVAERVPHLAKLAPASDVF-IEDLHEAGGVSAAL 328 Bacillus subtil...
WP_010870789 256 ILTKEAFENAILVDLALGGSTNTTLHIPAIANEV-KpKFITLDDFDRLSGEVPHIASLRPGGEHF-IIDLHRAGGIPAVL 333 Methanocaldococ...
WP_001656088 259 IASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEA-E-IDFTMSDIDKLSRKVPQLCKVAPSTQKYhMEDVHRAGGVIGIL 336 Escherichia coli
O27498       248 IMSQEAFENAVMVDLALGGSTNTTLHIPAIAAEIdG-LNINLDLFDELSRVIPHIASISPAGEHM-MLDLDRAGGIPAVL 325 Methanothermoba...
P44851       259 IGTFDAFENAMSLDIAMGGSSNTVLHLLAAAQEA-G-VDFKMEDIDRLSRKVPCLSKIAPNTNKYhMEDVHRAGGIMGLL 336 Haemophilus inf...
P74689       252 ILTRKAFENAIAVIMAVGGSTNAVLHLLAIANTI-G-VPLSLDDFETIRHKVPVLCDLKPSGKYV-TTNLHAAGGIPQVM 328 Synechocystis s...
P39522       278 ILTKEAFENAITYVVATGGSTNAVLHLVAVAHSA-G-VKLSPDDFQRISDTTPLIGDFKPSGKYV-MADLINVGGTQSVI 354 Saccharomyces c...
AAA96629     252 IVTVKAIDNAFALDMALGGSTNTVLHTLALANEA-G-VEYSLERINEVAERVPHLAKLAPASDVF-IEDLHEAGGVSAAL 328 Bacillus subtil...
WP_010870789 256 ILTKEAFENAILVDLALGGSTNTTLHIPAIANEV-KpKFITLDDFDRLSGEVPHIASLRPGGEHF-IIDLHRAGGIPAVL 333 Methanocaldococ...
WP_001656088 259 IASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEA-E-IDFTMSDIDKLSRKVPQLCKVAPSTQKYhMEDVHRAGGVIGIL 336 Escherichia coli
O27498       248 IMSQEAFENAVMVDLALGGSTNTTLHIPAIAAEIdG-LNINLDLFDELSRVIPHIASISPAGEHM-MLDLDRAGGIPAVL 325 Methanothermoba...
O29248       325 KKA---RKYFHDE-MTVSGKTLYEIAEMAVLR---------------------------------GRD------------ 355 Archaeoglobus f...
P44851       337 GELd-rAGLIHKNtHTVLGMSMGEQLDQYDIIrnqdeelhkffragpagirttqafsqdcrwdtvDNDrv---------- 405 Haemophilus inf...
P74689       329 KILl-vNGILHGDaLTITGQTIAEVLADIPDQpp------------------------------aGQD------------ 365 Synechocystis s...
P39522       355 KYLy-eNNMLHGNtMTVTGDTLAERAKKAPSLp-------------------------------eGQE------------ 390 Saccharomyces c...
AAA96629     329 NELskkEGALHLDaLTVTGKTLGETIAGHEVK---------------------------------DYD------------ 363 Bacillus subtil...
WP_010870789 334 KVL---EEKIRKEcLTVSGKTIGEIIKEVKYI---------------------------------DYS------------ 365 Methanocaldococ...
WP_001656088 337 GELd-rAGLLNRDvKNVLGLTLPQTLEQYDVMl-------------------------------tQDDavknmfragpag 384 Escherichia coli
O27498       326 KTL---EDHINREcVTCTGRTVQENIENVKVG---------------------------------HRD------------ 357 Methanothermoba...
P44851       337 GELd-rAGLIHKNtHTVLGMSMGEQLDQYDIIrnqdeelhkffragpagirttqafsqdcrwdtvDNDrv---------- 405 Haemophilus inf...
P74689       329 KILl-vNGILHGDaLTITGQTIAEVLADIPDQpp------------------------------aGQD------------ 365 Synechocystis s...
P39522       355 KYLy-eNNMLHGNtMTVTGDTLAERAKKAPSLp-------------------------------eGQE------------ 390 Saccharomyces c...
AAA96629     329 NELskkEGALHLDaLTVTGKTLGETIAGHEVK---------------------------------DYD------------ 363 Bacillus subtil...
WP_010870789 334 KVL---EEKIRKEcLTVSGKTIGEIIKEVKYI---------------------------------DYS------------ 365 Methanocaldococ...
WP_001656088 337 GELd-rAGLLNRDvKNVLGLTLPQTLEQYDVMl-------------------------------tQDDavknmfragpag 384 Escherichia coli
O27498       326 KTL---EDHINREcVTCTGRTVQENIENVKVG---------------------------------HRD------------ 357 Methanothermoba...
O29248       356 -----------------------IIASPDNPLHKEGGIAILKGNLAENGAVIKAAAVSEDMMRFEGTAKVYDSEKEALNA 412 Archaeoglobus f...
P44851       406 ---------------------ngCIRNKENAISQEGGLAVLFGNLAEDGCIVKTAGVDESIWKFTGTAIVFESQEDAVAG 464 Haemophilus inf...
P74689       366 -----------------------VIHSWDDPVYQEGHLAVLKGNLATEGSVAKISGVKK--PVITGPAKVFESEEDCLEA 420 Synechocystis s...
P39522       391 -----------------------IIKPLSHPIKANGHLQILYGSLAPGGAVGKITGKEG--TYFKGRARVFEEEGAFIEA 445 Saccharomyces c...
AAA96629     364 -----------------------VIHPLDQPFTEKGGLAVLFGNLAPDGAIIKTGGVQNGITRHEGPAVVFDSQDEALDG 420 Bacillus subtil...
WP_010870789 366 -----------------------VIRPVDNPVHETAGLRILKGSLAPNGAVVKIGAVNPKMYKHEGPARVFDSEEEAVDA 422 Methanocaldococ...
WP_001656088 385 irttqafsqdcrldtldddrangCIRSLEHAYSKDGGLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEA 464 Escherichia coli
O27498       358 -----------------------VIRPLDSPVHSEGGLAILRGNLAPRGSVVKQGAVAEDMMVHEGPAKVFNSEDECMEA 414 Methanothermoba...
P44851       406 ---------------------ngCIRNKENAISQEGGLAVLFGNLAEDGCIVKTAGVDESIWKFTGTAIVFESQEDAVAG 464 Haemophilus inf...
P74689       366 -----------------------VIHSWDDPVYQEGHLAVLKGNLATEGSVAKISGVKK--PVITGPAKVFESEEDCLEA 420 Synechocystis s...
P39522       391 -----------------------IIKPLSHPIKANGHLQILYGSLAPGGAVGKITGKEG--TYFKGRARVFEEEGAFIEA 445 Saccharomyces c...
AAA96629     364 -----------------------VIHPLDQPFTEKGGLAVLFGNLAPDGAIIKTGGVQNGITRHEGPAVVFDSQDEALDG 420 Bacillus subtil...
WP_010870789 366 -----------------------VIRPVDNPVHETAGLRILKGSLAPNGAVVKIGAVNPKMYKHEGPARVFDSEEEAVDA 422 Methanocaldococ...
WP_001656088 385 irttqafsqdcrldtldddrangCIRSLEHAYSKDGGLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEA 464 Escherichia coli
O27498       358 -----------------------VIRPLDSPVHSEGGLAILRGNLAPRGSVVKQGAVAEDMMVHEGPAKVFNSEDECMEA 414 Methanothermoba...
O29248       413 ILDGKVEEGD--VVVIRYMGPKGAPGMPEMLLPTAAISGLGLQK-VALITDGRFSGATRGPCIGHVSPEAAVGGNIALVE 489 Archaeoglobus f...
P44851       465 ILGGKVKEGH--VVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKkCALLTDGRFSGGTSGLSIGHVSPEAASGGAIGLVR 542 Haemophilus inf...
P74689       421 ILAGKIQAGD--VVVVRYEGPKGGPGMREMLAPTSAIIGAGLGDsVGLITDGRFSGGTYGLVVGHVAPEAYVGGAIALVQ 498 Synechocystis s...
P39522       446 LERGEIKKGEktVVVIRYEGPRGAPGMPEMLKPSSALMGYGLGKdVALLTDGRFSGGSHGFLIGHIVPEAAEGGPIGLVR 525 Saccharomyces c...
AAA96629     421 IINRKVKEGD--VVIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPkVALITDGRFSGASRGLSIGHVSPEAAEGGPLAFVE 498 Bacillus subtil...
WP_010870789 423 ILGGDIERGD--VVVIRYEGPAGGPGMREMLAPTSAICGMGLDDsVALITDGRFSGGSRGPCIGHVSPEAMAGGPIAIVE 500 Methanocaldococ...
WP_001656088 465 ILGGKVVAGD--VVVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKaCALITDGRFSGGTSGLSIGHVSPEAASGGSIGLIE 542 Escherichia coli
O27498       415 IFGGRIDEGD--VIVIRYEGPKGGPGMREMLNPTSAIAGMGLER-VALITDGRFSGGTRGPCVGHVSPEAMEDGPLAAVN 491 Methanothermoba...
P44851       465 ILGGKVKEGH--VVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKkCALLTDGRFSGGTSGLSIGHVSPEAASGGAIGLVR 542 Haemophilus inf...
P74689       421 ILAGKIQAGD--VVVVRYEGPKGGPGMREMLAPTSAIIGAGLGDsVGLITDGRFSGGTYGLVVGHVAPEAYVGGAIALVQ 498 Synechocystis s...
P39522       446 LERGEIKKGEktVVVIRYEGPRGAPGMPEMLKPSSALMGYGLGKdVALLTDGRFSGGSHGFLIGHIVPEAAEGGPIGLVR 525 Saccharomyces c...
AAA96629     421 IINRKVKEGD--VVIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPkVALITDGRFSGASRGLSIGHVSPEAAEGGPLAFVE 498 Bacillus subtil...
WP_010870789 423 ILGGDIERGD--VVVIRYEGPAGGPGMREMLAPTSAICGMGLDDsVALITDGRFSGGSRGPCIGHVSPEAMAGGPIAIVE 500 Methanocaldococ...
WP_001656088 465 ILGGKVVAGD--VVVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKaCALITDGRFSGGTSGLSIGHVSPEAASGGSIGLIE 542 Escherichia coli
O27498       415 IFGGRIDEGD--VIVIRYEGPKGGPGMREMLNPTSAIAGMGLER-VALITDGRFSGGTRGPCVGHVSPEAMEDGPLAAVN 491 Methanothermoba...
O29248       490 DGDKISIDIPARKLEVKLSDEELAERRAKWKPKE----------KELKGYLAKYAKLVRGAEEGAALL 547 Archaeoglobus fulgidus DSM ...
P44851       543 NGDIINIDIPNRAINLEISNEELATRRAEQDQKGwqpa---nreREVSFALKVFGHFATSADKGAVRD 607 Haemophilus influenzae Rd KW20
P74689       499 EGDQITIDAGKRLLQLNISEEELAQRRAQWTPPQp---------RYPRGILAKYAKLVSSSSLGAVTD 557 Synechocystis sp. PCC 6803 ...
P39522       526 DGDEIIIDADNNKIDLLVSDKEMAQRKQSWVAPPp---------RYTRGTLSKYAKLVSNASNGCVLD 584 Saccharomyces cerevisiae S288c
AAA96629     499 NGDHIIVDIEKRILDVQVPEEEWEKRKANWKGFEp---------KVKTGYLARYSKLVTSANTGGIMK 557 Bacillus subtilis subsp. su...
WP_010870789 501 DGDIIKIDMINKKLDLALDEEEIKERLAKWKKPEp---------KVKKGYLARYAKLVSSADEGAVLR 559 Methanocaldococcus jannaschii
WP_001656088 543 DGDLIAIDIPNRGIQLQVSDAELAARREAQDARGdkawtpknreRQVSFALRAYASLATSADKGAVRD 610 Escherichia coli
O27498       492 DGDIIRIDIPSRKLEVDLSPREIEERLQSAVKPR----------RSVKGWLARYRKLAGSADTGAVLR 549 Methanothermobacter thermau...
P44851       543 NGDIINIDIPNRAINLEISNEELATRRAEQDQKGwqpa---nreREVSFALKVFGHFATSADKGAVRD 607 Haemophilus influenzae Rd KW20
P74689       499 EGDQITIDAGKRLLQLNISEEELAQRRAQWTPPQp---------RYPRGILAKYAKLVSSSSLGAVTD 557 Synechocystis sp. PCC 6803 ...
P39522       526 DGDEIIIDADNNKIDLLVSDKEMAQRKQSWVAPPp---------RYTRGTLSKYAKLVSNASNGCVLD 584 Saccharomyces cerevisiae S288c
AAA96629     499 NGDHIIVDIEKRILDVQVPEEEWEKRKANWKGFEp---------KVKTGYLARYSKLVTSANTGGIMK 557 Bacillus subtilis subsp. su...
WP_010870789 501 DGDIIKIDMINKKLDLALDEEEIKERLAKWKKPEp---------KVKKGYLARYAKLVSSADEGAVLR 559 Methanocaldococcus jannaschii
WP_001656088 543 DGDLIAIDIPNRGIQLQVSDAELAARREAQDARGdkawtpknreRQVSFALRAYASLATSADKGAVRD 610 Escherichia coli
O27498       492 DGDIIRIDIPSRKLEVDLSPREIEERLQSAVKPR----------RSVKGWLARYRKLAGSADTGAVLR 549 Methanothermobacter thermau...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap