3OCC,4D8V


Conserved Protein Domain Family
deoD

?
TIGR00107: deoD 
Click on image for an interactive view with Cn3D
purine-nucleoside phosphorylase, family 1 (deoD)
Purine nucleoside phosphorylase (also called inosine phosphorylase) is a purine salvage enzyme. Purine nucleosides, such as guanosine, inosine, or xanthosine, plus orthophosphate, can be converted to their respective purine bases (guanine, hypoxanthine, or xanthine) plus ribose-1-phosphate. This family of purine nucleoside phosphorylase is restricted to the bacteria. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 188024
View PSSM: TIGR00107
Aligned: 8 rows
Threshold Bit Score: 366.79
Threshold Setting Gi: 504707264
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OCC_A         5 HINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVK 84  Yersinia pseudo...
P44417         4 HINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVK 83  Haemophilus inf...
O34925         4 HIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQ 83  Bacillus subtil...
P56463         4 HINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGRGISLMGHGMGIASCTIYVTELIKTYQVK 83  Helicobacter py...
WP_001322562  24 HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVK 103 Escherichia coli
P75053         4 HINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGKTITIMGHGMGIPSIGIYSYELMKFYEVN 83  Mycoplasma pneu...
4D8V_A        24 HIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQ 103 Bacillus subtilis
WP_014894366  30 HISAKKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGIPSIGIYSYELMNFYEVE 109 Mycoplasma geni...
3OCC_A        85 KIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYT 162 Yersinia pseudo...
P44417        84 KIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRIRFKDN--DFAAIADFDMAQAAVQAAKAKGKVVRVGNLFSADLFYT 161 Haemophilus inf...
O34925        84 NLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSV--DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYN 161 Bacillus subtil...
P56463        84 ELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNH--DLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYS 161 Helicobacter py...
WP_001322562 104 KIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYS 181 Escherichia coli
P75053        84 TIIRIGSCGALQGSLNLQDLIIAAKAWSESIYANDMGVEVpaDKILMASPQLVELAKKTANQLQLAFHEGLVFCEDAFHQ 163 Mycoplasma pneu...
4D8V_A       104 NLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSV--DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYN 181 Bacillus subtilis
WP_014894366 110 TIIRIGSCGALAPQLKLKDLVIASKAWSESIYAKDMGVEIpeDKILFATSSLVELAKETAIKNKLDFHEGLVFCEDAFYQ 189 Mycoplasma geni...
3OCC_A       163 PDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG 236 Yersinia pseudotuberc...
P44417       162 PDVEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSVLIG 235 Haemophilus influenza...
O34925       162 DD-SQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ- 233 Bacillus subtilis sub...
P56463       162 FETHAFDLMAKYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERVESFDNMIILALEMMS-- 233 Helicobacter pylori 2...
WP_001322562 182 PDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG 255 Escherichia coli
P75053       164 IRKDVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHAALPAEQRQATFKNMAILSLEMASQL 237 Mycoplasma pneumoniae...
4D8V_A       182 DD-SQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVSQ- 253 Bacillus subtilis
WP_014894366 190 TRKDVISLAKEKNSLAVEMEAHALYANAILLKKKALTLLTVSDSLVTHEALSSELRQKSFKQMALLALEMTQKL 263 Mycoplasma genitalium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap