4HI0


Conserved Protein Domain Family
ureG

?
TIGR00101: ureG 
Click on image for an interactive view with Cn3D
urease accessory protein UreG
This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 129208
View PSSM: TIGR00101
Aligned: 4 rows
Threshold Bit Score: 375.357
Threshold Setting Gi: 2501642
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HI0_E   1 MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLE 80  Helicobacter pylori G27
Q09066   1 MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLE 80  Helicobacter pylori 2...
P72955   5 PLRIGIAGPVGSGKTALLEALCKALRQKYQLAVVTNDIYTQEDAQFLVRAEALTPDRILGVETGGCPHTAIREDASLNLA 84  Synechocystis sp. PCC...
P44396  18 YIKIGVAGPVGAGKTALIEKLTREIASKYSVAVITNDIYTQEDAEFLTKNSLLPPERIMGVETGGCPHTAIREDASMNLE 97  Haemophilus influenza...
4HI0_E  81 AVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM 160 Helicobacter pylori G27
Q09066  81 AVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM 160 Helicobacter pylori 2...
P72955  85 AIADLEARFMPLDMVFLESGGDNLAATFSPELVDLTLYVIDVAAGDKIPRKGGPGITKSDLLVINKIDLAPMVGADLGIM 164 Synechocystis sp. PCC...
P44396  98 AVDEMVTRFPDVEIVFIESGGDNLSATFSPDLADVTIFVIDVAQGEKIPRKGGPGITRSDLLVINKTDLAPFVGADLSVM 177 Haemophilus influenza...
4HI0_E 161 ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED 199 Helicobacter pylori G27
Q09066 161 ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED 199 Helicobacter pylori 26695
P72955 165 DRDAKKMRGEKPFVFTNLKTATGLSTVVDFVEHYLPTKV 203 Synechocystis sp. PCC 6803 substr. Kazusa
P44396 178 ERDARRMRNGQPFIFTNLMKKENLDGVIGWIEKYALLKN 216 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap