Conserved Protein Domain Family
TIGR00096

?
TIGR00096: TIGR00096 
16S rRNA (cytidine(1402)-2'-O)-methyltransferase
This protein, previously known as YraL, is RsmI, one of a pair of genes involved in a unique dimethyl modification of a cytidine in 16S rRNA. See pfam00590 (tetrapyrrole methylase), which demonstrates homology between this family and other members, including several methylases for the tetrapyrrole class of compound, as well as the enzyme diphthine synthase. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129204
View PSSM: TIGR00096
Aligned: 6 rows
Threshold Bit Score: 325.238
Threshold Setting Gi: 446888031
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45298         7 ILYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHY-----------GIKKPFFALHDHNEQEKAHILVEKL 75  Haemophilus inf...
P45528        14 LYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFG-----------INARLFALHDHNEQQKAETLLAKLQ 82  Escherichia coli
P47302         4 LKVVATPIGNIQEISERAKKALQDCEVLFCEDSRVTRKMLDLLN-----------IDCKQKKFVINNSFKEKQNLTFAEE 72  Mycoplasma geni...
P75046         4 LKVIATPIGNIEEVSPRVKAALTKCEVLFCEDTRVTKKLLGLLG-----------IDFSNKQFIINNEFKEKQNLSKVAN 72  Mycoplasma pneu...
P74038         3 ILYLVATPIGNLGDMTPRAVETLQTVDLIAAEDTRHTGKLLQHF-----------QITTPQISYHDHNRHGRTQELLAKL 71  Synechocystis s...
WP_000965287   1 MLYFLPTPIGNLADITLRALEVLERCEVFLCEDTRVSKRLLHLLaqnpiishsfpNIATKKREFIAFHSHNDQEFLNQIK 80  Helicobacter py...
P45298        76 KQGSN--IALISDAGTPLISDPGFHLVRQCREAG--IRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLE 151 Haemophilus inf...
P45528        83 EGQNI--ALVSDAGTPLINDPGYHLVRTCREAGI--RVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKA 158 Escherichia coli
P47302        73 FITNFkcCLVSDAGYPSLSDPGNEMINWIISKNKeiRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYLST 152 Mycoplasma geni...
P75046        73 LIHQYhcGLVSDAGYPSVSDPGHILVEYVRTQLPqiAIEVINGPSALVCGLVTSGFPESPLLFLGFLDHKPTQVTQTLKH 152 Mycoplasma pneu...
P74038        72 QAGQN--IALVSDAGTPGISDPGQELVAACGEAN--IEVIPIPGATALIAALISSGLATDRFVFEGFLSTKNRPRQQLLQ 147 Synechocystis s...
WP_000965287  81 PSFFDkeIAVMSDAGMPSLSDPGMSLAAYALKHN--IQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIA 158 Helicobacter py...
P45298       152 NI------AEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEM-VL 224 Haemophilus inf...
P45528       159 IE------AEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMV-LI 231 Escherichia coli
P47302       153 YQ------NQKSTIVFFEAVHRLENTLETVKNVFKNNDVFIGRELTKLHESHYWFNTSENTLPDIT--L---KGEFViVI 221 Mycoplasma geni...
P75046       153 YQ------NFQGTIVLFEAVHRLQQTLEVIQTVFSNTEVFVGRELTKLHESHYWFNTSAPL-PDIT--L---KGEFViVI 220 Mycoplasma pneu...
P74038       148 SL------AQEERTIILYEAPHRLLATLTDLQTFLGQERSLTVARELTKYHEQFWRGTLQTAIAYF--TENTPKGEFcLV 219 Synechocystis s...
WP_000965287 159 KIlnalayLEEKTPVVFYESPHRLLETLKDLNDLAKGMHLFAAKELTKLHQQYYLGEVSQIIERLQQST---IQGEWvLV 235 Helicobacter py...
P45298       225 IVEGKPKSDnnDEISPQAVKALELIAEELPLKKAAAIVAELYGYKKNALYQFGLahL 281 Haemophilus influenzae Rd KW20
P45528       232 VEGHKAQEE--DLPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYALE--Q 284 Escherichia coli
P47302       222 DNQNINHQTlsSNQYLVYEIKKLMDIGVKLKDACNYLAKKMHLKSSMLYTLFHE--S 276 Mycoplasma genitalium G37
P75046       221 NNHHTQPVGqySDQLLKQEITQLVQMGVKVKDACHYLAKRLQLKSNKLYTLFHE--S 275 Mycoplasma pneumoniae M129
P74038       220 IAGATPEDRpsFSEENLRDELRSLMAKGLTRSQASRQLAEETKLPRRQLYQLSLelE 276 Synechocystis sp. PCC 6803 substr. Kazusa
WP_000965287 236 LLNEKKIEPcmGLS--------ALLELDLPPKIKAKIEAVMTQKNAKELYFQRLleE 284 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap