1JAL


Conserved Protein Domain Family
TIGR00092

?
TIGR00092: TIGR00092 
Click on image for an interactive view with Cn3D
GTP-binding protein YchF
This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor. [Unknown function, General]
Statistics
?
PSSM-Id: 129200
View PSSM: TIGR00092
Aligned: 7 rows
Threshold Bit Score: 493.524
Threshold Setting Gi: 732143
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JAL_A         1 MgFKCGIVGLPNVGKSTLFNALTKAGI-EAANYPFCTIEPNTGVVPMPDPRLDALAEIVKPERI-LPTTMEFVDIAGLVA 78  Haemophilus inf...
P47270         1 M-LSAGIVGLPNVGKSTLFSAITNLQV-EIANYPFATIEPNTGIVNVSDERLDKLASLINPEKI-VYTTFRFVDIAGLVK 77  Mycoplasma geni...
P75088         1 M-LSAGIVGLPNVGKSTLFSAITNLQV-EIANYPFATIEPNAGIVNVIDERLDKLASLIKPDKV-THTTFRFVDIAGLVK 77  Mycoplasma pneu...
P38219        20 NlKAGIVGLANVGKSTFFQAITRCPLGnPANYPFATIDPEEARVIVPSPRFDKLCEIYKKTASEvPAHLTVYDIAGLTKG 99  Saccharomyces c...
WP_000505866   1 MgFKCGIVGLPNVGKSTLFNALTKAGI-EAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRT-LPTTMEFVDIAGLVK 78  Enterobacteriaceae
P38746        16 NpTSGIVGLANVGKSTFFQAITNSKLGnPANYPFATIDAECAKVNIPSVPLSNLLRIYQSAKCV-PGTLTIYDIAGLTRG 94  Saccharomyces c...
WP_010872577   1 -mLRAGIVGLPNVGKSTLFNALVANAKaEAANFPFCTIEPNVGVVSVPDDRLGKLAEISQSVKV-VPTRMEFVDIAGLVA 78  Synechocystis s...
1JAL_A        79 GASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKIDPLDDIDTINTELALADLDSCE-------RAIQRLQKRA 151 Haemophilus inf...
P47270        78 GASQGQGLGNQFLANIREVDLICHVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELIT-------NRIGKLKRKA 150 Mycoplasma geni...
P75088        78 GASKGEGLGNQFLANIREVDLICHVVRCYEDKKIVHVNNQVDPVFDFEIIVNELIQADIEVVN-------TRIGKIKRKA 150 Mycoplasma pneu...
P38219       100 ASAGEGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHVEGDVDPVRDLEIINQELRLKDIEFAQKaleg-aekIAKRGGQSL 178 Saccharomyces c...
WP_000505866  79 GASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVSGKVNPADDIEVINTELALADLDTCE-------RAIHRVQKKA 151 Enterobacteriaceae
P38746        95 ASQGHGLGNKFLNDIRHVEGIFQVVRGFLKEDITHIEGNVDPVRDLSVVQDELILKDLEFLENirerlskKMRMVSKNSK 174 Saccharomyces c...
WP_010872577  79 GASKGEGLGNQFLANIREVDAIVHVVRCFDDDDIIHVSGSVDPVRDVEVIDLELVLADLAQVE-------KRLERSRKQA 151 Synechocystis s...
1JAL_A       152 KGGdKEAKFELSVMEKILPVLENAGMIRSVg--LDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN--NPYLDRVREIAA 227 Haemophilus inf...
P47270       151 ESGdKIAKEEFVLLEIVLNGLKQGQMPIQT---LSESELKTIKSLNLLTAKPILIVANVSENDLLNldNNEALKKLNAFL 227 Mycoplasma geni...
P75088       151 ESGdKQSKEEYQLLAPVLQGLQQNQMVLHL---VNEVDLKKLKSLNLLTAKPILVVANVSEADLSNldHNPHLTQLNQFL 227 Mycoplasma pneu...
P38219       179 EVK-QKKEEMDLITKIIKLLESGQRVANHSw--TSKEVEIINSMFLLTAKPCIYLINLSERDYIRKknKHLLRIKEWVDK 255 Saccharomyces c...
WP_000505866 152 KGGdKDAKAELAVLEKCLPQLENAGMLRALd--LSAEEKAAIRYLSFLTLKPTMYIANVNEDGFEN--NPYLDQVREIAA 227 Enterobacteriaceae
P38746       175 EHQ-EMKIETELLDALEEHLFNGKKIRHFKdhwNLDEVKILNKHNFLTSKPTLILLNVSPQDYVRNenKFVRNIIEWINE 253 Saccharomyces c...
WP_010872577 152 RGN-KDLLEEVAILERLVAALNEGIPARRVg--LTAEEQELIKSLGLLTLKPIIYATNVTEDDLAGg-NDWVEQVKAIAA 227 Synechocystis s...
1JAL_A       228 --KEGAVVVPVCAAIESEIAELDDEEKVEFLQDLGi------EEP-GLNRVIRAGYALLNLQTYFTAGVKEVRAWTVSVG 298 Haemophilus inf...
P47270       228 dqKKIPKAITVCSLIEKELSGLKLEQRQYFLDELGl------KNYsGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKKG 301 Mycoplasma geni...
P75088       228 kqHNLPHAIPVCALLENELSSLDANGRQDWLKELGl------SDYqGLNQLIKTAYDAIGLWSFFTFGKQEVRAWAFKKG 301 Mycoplasma pneu...
P38219       256 ysPGDLIIPFSVSLEERLSH--MSPEDAEEELKKLq------TISaLPKIITTMRQKLDLISFFTCGPDEVREWTIRRGT 327 Saccharomyces c...
WP_000505866 228 --KEGSVVVPVCAAVEADIAELDDEERDEFMQELGl------EEP-GLNRVIRAGYKLLNLQTYFTAGVKEVRAWTIPVG 298 Enterobacteriaceae
P38746       254 fsPGDKFLLFSAEFESQLMECKGIASEYFDKIKEDtnvsdqqLVSaIPQIILEMRKLLNLISFFTCGPQEVHQWNIREGT 333 Saccharomyces c...
WP_010872577 228 --KDEAKVVVISAQVESELVELPEEERQDFLASLGv------TEG-GLKSLIRATYELLGLRTYLTTGPQETRAWTIISG 298 Synechocystis s...
1JAL_A       299 ATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFN---GENGAKEAGKWRLEGKDYIVQDGDVMHFRFN-V 363 Haemophilus influenzae
P47270       302 WNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMK---SLQEAKKQGLIRLEGKNYLIKDGDVCNFKFN-V 366 Mycoplasma genitalium G37
P75088       302 WLAPQCAGEIHTDFERGFIKVEVISWNQLYELK---SLQEAKKQGLVRLRG----QGLRDARWWCVS-L 362 Mycoplasma pneumoniae M129
P38219       328 KAPQAAGVIHNDLMNTFILAQVMKCEDVFEYKD---DSAIKAAGKLMQKGKDYVVEDGDIIYFRAGAgK 393 Saccharomyces cerevisiae S...
WP_000505866 299 ATAPQAAGKIHTDFEKGFIRAQTISFEDFITYK---GEQGAKEAGKMRAEGKDYIVKDGDVMNFLFN-V 363 Enterobacteriaceae
P38746       334 TAQEAAGVIHSDLRETFISADVIKYDDLKKMEPplnESLLKSKGLIKRAGKQYIMQDNDIALFKAAGgK 402 Saccharomyces cerevisiae S...
WP_010872577 299 MKAPQAAGVIHTDFERGFIRAETVAYEDLISCG---SMQGAKEKGLVRSEGKEYVVQEGDVLLFRFN-V 363 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap