3DXX,2FCA,2VDV


Conserved Protein Domain Family
TIGR00091

?
TIGR00091: TIGR00091 
Click on image for an interactive view with Cn3D
tRNA (guanine-N(7)-)-methyltransferase
This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria. It is also found, with a short amino-terminal extension in eukaryotes. Its function is unknown. In E. coli, this protein flanks the DNA repair protein MutY, also called micA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 161703
View PSSM: TIGR00091
Aligned: 11 rows
Threshold Bit Score: 231.867
Threshold Setting Gi: 14194919
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DXX_A        19 EFSEDMLDFPALFG---REAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEV--------HSPGVGACLASAHEEGLS--N 85  Escherichia col...
P32049        48 EFSEDMLDFPALFG---REAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEV--------HSPGVGACLASAHEEGLS--N 114 Escherichia coli
P44648        56 DYQTEPFDFAKIYG---NDNPVVLEIGFGMGKSLVDMAFANPDKNYLGIEV--------HTPGVGACIAYAVEKGVT--N 122 Haemophilus inf...
O25443       102 KKTLDLGTFEDFIQk--NQAPILIEIGFGSGRHLIELAKNNPTKTCLGIEI--------HTPSIAQALKQIELLDLK--N 169 Helicobacter py...
O34522        23 nPADYKGKWNTVFG---NDNPIHIEVGTGKGQFISGMAKQNPDINYIGIEL--------FKSVIVTAVQKVKDSEAQ--N 89  Bacillus subtil...
P75256        17 pYFSNPEQLSTIE-----SESLFVEIGCGKSWFLSQQAQQNPKCFFVGIER--------EPTIVLKAINKVNRLEVKprN 83  Mycoplasma pneu...
P47589        17 pYFYSKDKFAKFT-----KKQLVLELGCGKGTFLIKEAQKNNNFLFIGIER--------EPTIVLKAINKINKLDFNleN 83  Mycoplasma geni...
WP_015390137   1 --MLACPDWATVYDd--VQRPLHLDIGCARGRFPLKMAQQHPDWNFLGVEI--------RQPLVLEANETGDRLGLK--N 66  Synechocystis s...
CAA67468      77 DWSKLYPYYKNAENgqmTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIrvqvtnyvEDRIIALRNNTASKHGFQ--N 154 baker's yeast
2FCA_A        23 nPADYKGKWNTVFG---NDNPIHIEVGTGKGQFISGMAKQNPDINYIGIEL--------FKSVIVTAVQKVKDSEAQ--N 89  Bacillus subtilis
2VDV_E        31 DWSKLYPYYKNAENgqmTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIrvqvtnyvEDRIIALRNNTASKHGFQ--N 108 baker's yeast
3DXX_A        86 LRVMCHDAVEVLHKMIPDN--SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVM 163 Escherichia col...
P32049       115 LRVMCHDAVEVLHKMIPDN--SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVM 192 Escherichia coli
P44648       123 LRVICHDATEILRDSIADG--ALGGLQLFFPDPWHKAKHHKRRIVQPHFVTQVIQKLGENGFIHMATDWENYAEQMLEVL 200 Haemophilus inf...
O25443       170 LHILQGDG-RLVLESMPNH--RCEKIFVHFPVPWNEKKH--RRVLSEKFLNEALRVLKPRGFLELRTDDSLYFEDSLKLA 244 Helicobacter py...
O34522        90 VKLLNIDADTLTDVFEPG---EVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKGGSIHFKTDNRGLFEYSLKSF 166 Bacillus subtil...
P75256        84 LLITCLDANQLTEYLKPQ---SISKIFINFPDPWPKKRHTLRRLTAPHFLKQFHQLLKKQGLIEFKTDNDQLFEFTLEVL 160 Mycoplasma pneu...
P47589        84 ILLLCTDAKQLDDYFQAE---SVQKIFINFPDPWPKKRHIQRRLTSPDFLKLFWNLLVKNGLIEFKTDNDKLFEYTLTTL 160 Mycoplasma geni...
WP_015390137  67 LHYLFGNINVEPEKFFSAFppTLQRVSIQFPDPWFKQRHNKRRVAQPELVTAIANALPPGGEVLLQSDVEPVAQDMRDRF 146 Synechocystis s...
CAA67468     155 INVLRGNAMKFLPNFFEKG--QLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHL 232 baker's yeast
2FCA_A        90 VKLLNIDADTLTDVFEP-G--EVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKGGSIHFKTDNRGLFEYSLKSF 166 Bacillus subtilis
2VDV_E       109 INVLRGNAMKFLPNFFEKG--QLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHL 186 baker's yeast
3DXX_A       164 SSID-GYKNLSESNDYVPRPASRP--------VTKFEQRGHRLGHGVWDLMFERVK 210 Escherichia coli K-12
P32049       193 SSID-GYKNLSESNDYVPRPASRP--------VTKFEQRGHRLGHGVWDLMFERVK 239 Escherichia coli
P44648       201 SANT-DLVNTSKNGDYIPRPDFRP--------LTKFEARGYKLGHGVWDLYFVKK- 246 Haemophilus influenzae Rd KW20
O25443       245 LKNFqCEIEIKKNAQIPVVSKYEArwnklkkdIYDLRIYSLEWNETPFDNHAFDFS 300 Helicobacter pylori 26695
O34522       167 SEYG--LLLTYVSLDLHNSNLEGNi-------MTEYEEKFSALGQPIYRAEVEWRT 213 Bacillus subtilis subsp. subtilis str. 168
P75256       161 QKTVaHFKIIEQTTDLHNSPLTSTn------iMTEYEQRFVSLGVKIKKLTLEKLN 210 Mycoplasma pneumoniae M129
P47589       161 QENSqIFEIIHQITDLNNSEFSFQn------sITEYEQRFMELEIPIKKLVIKKII 210 Mycoplasma genitalium G37
WP_015390137 147 AEND-NFVFTHDTPWLAENPLGVP---------TEREIACFNLQRPVYRCLLQRTP 192 Synechocystis sp. PCC 6803
CAA67468     233 EEHP-LFERLSKEWEENDECVKIMr------nATEEGKKVERKKGDKFVACFTRLP 281 baker's yeast
2FCA_A       167 SEYG-LLL-TYVSLDLHNSNLEGn-------iMTEYEEKFSALGQPIYRAEVEWRT 213 Bacillus subtilis
2VDV_E       187 EEHP-LFERLSKEWEENDECVKIMr------nATEEGKKVERKKGDKFVACFTRLP 235 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap