1P9P


Conserved Protein Domain Family
trmD

?
TIGR00088: trmD 
Click on image for an interactive view with Cn3D
tRNA (guanine-N1)-methyltransferase
This model is specfic for the tRNA modification enzyme tRNA (guanine-N1)-methyltransferase (trmD). This enzyme methylates guanosime-37 in a number of tRNAs.The enzyme's catalytic activity is as follows: S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing N1-methylguanine. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129196
View PSSM: TIGR00088
Aligned: 9 rows
Threshold Bit Score: 377.133
Threshold Setting Gi: 3915141
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P9P_A         7 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAG- 85 
P43912         1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGe 80  Haemophilus inf...
O31741         1 MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAa 80  Bacillus subtil...
P72828         1 MQFDVLTLFPDFFTSPLQSGLLGKALEKAIASVNLINPRDFTTDKHRRVDDEPYGGGVGMVIKPEPIFAAVESLPVLSKr 80  Synechocystis s...
O51641         1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESAKK- 79  Borrelia burgdo...
P47683         1 MKITVLTLFENTIWPYLNSSIMLQAQKANLVQFEVVNWRNFCNDKHKTVDDMAYGGGSGMVLKAEPIINCLNFYKAPNS- 79  Mycoplasma geni...
O25766         1 MKFSVLTLFPQLVWPYFEDSILKRALEKNLFELEVLNLRDFSANKYQKADHTLIGGGAGQILDPEMVENALHSVKNPKH- 79  Helicobacter py...
WP_017532956   1 mkitvltlfeqvvwpylnasiMAQAQKAKLVEFEVINWRQYCKDKHQTVDDMAYGGGGGMVLKAEPILKALKACRTPQS- 79  Mycoplasma pneu...
P07020         1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGe 80  Escherichia coli
1P9P_A        86 --EgakVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIP 163
P43912        81 gaK---VIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIP 157 Haemophilus inf...
O31741        81 apR---IILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLP 157 Bacillus subtil...
P72828        81 --E---VILMTPQGQPMDQALFRELTNYDQLVLICGHYEGVDERVCQ-LVTREVSLGDFVLTCGEIPALTLINGVIRLLP 154 Synechocystis s...
O51641        80 --T---TIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLD 154 Borrelia burgdo...
P47683        80 --H---VVLLSPEGEQFSQNCAKKLTKYEHLILLSGHYEGFDQRIYK-YIDQIVSLGDFVLSGGELVALSVIDATVRLIK 153 Mycoplasma geni...
O25766        80 --T---IFLSAVGKPFKQTDAMR-LAQKKHVVLVCGRYEGFDERSIELGADEVFCIGDFILTGGELGALCLIDSIARHIQ 153 Helicobacter py...
WP_017532956  80 --K---VVLLSPEGQQFSQPMAQALTQTEHLILICGHYEGFDYRLYK-HVDQIISLGDFVLSGGELVALSVIDATVRLIK 153 Mycoplasma pneu...
P07020        81 gaK---VIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIP 157 Escherichia coli
1P9P_A       164 GVLGHEASATEDSF--AEGLLDCPHYTRPE----VLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENl-ALT 236
P43912       158 GVLGKQASAEEDSF--ADGLLDCPHYTRPE----VLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGl-ALT 230 Haemophilus inf...
O31741       158 GVLGKEASHIEDSF--STGLLEHPHYTRPA----DYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDh-PLT 230 Bacillus subtil...
P72828       155 GTVGKEASLIAESF--STDLLDYPHYTRPP----VFRGLAVPPVLLSGNHQAIAQWRLEQQEERTQQRRPDLWQKwqDRQ 228 Synechocystis s...
O51641       155 GVINPN-SLLEESFgvKNGLLEYPHYTRPY----DFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKylEII 229 Borrelia burgdo...
P47683       154 GVINDQ-SLICESF--NDNLLDFPVYTRPY----DLKGDKVPEVLLSGDHQKIESFRKEQQILKTAKYRPDLYKKylENK 226 Mycoplasma geni...
O25766       154 GVLGNAQSLENESF--ENHYLEAPNFANAVfkskEINKIPAPLEYSKGNHAKIKQLKLDLSKLRTKFYRLDLFKQhkS-- 229 Helicobacter py...
WP_017532956 154 GVINDQ-SLIHESF--NNYLLDFPAYTRPY----DLDGDKVPEILLSGDHKKIEAYRKEQQLLRTAQYRPDLYKQylAKK 226 Mycoplasma pneu...
P07020       158 GVLGHEASATEDSF--AEGLLDCPHYTRPE----VLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENl-ALT 230 Escherichia coli
1P9P_A       237 EEQAR 241
P43912       231 DEQRK 235 Haemophilus influenzae Rd KW20
O31741       231 EQQRK 235 Bacillus subtilis subsp. subtilis str. 168
P72828       229 PSP-- 231 Synechocystis sp. PCC 6803 substr. Kazusa
O51641       230 GEDNG 234 Borrelia burgdorferi B31
P47683       227 NEKNK 231 Mycoplasma genitalium G37
O25766           -----     Helicobacter pylori 26695
WP_017532956 227 DEKNK 231 Mycoplasma pneumoniae
P07020       231 EEQAR 235 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap