Conserved Protein Domain Family
smpB

?
TIGR00086: smpB 
SsrA-binding protein
This model describes the SsrA-binding protein, also called tmRNA binding protein, small protein B, and SmpB. The small, stable RNA SsrA (also called tmRNA or 10Sa RNA) recognizes stalled ribosomes such as occur during translation from message that lacks a stop codon. It becomes charged with Ala like a tRNA, then acts as mRNA to resume translation started with the defective mRNA. The short C-terminal peptide tag added by the SsrA system marks the abortively translated protein for degradation. SmpB binds SsrA after its aminoacylation but before the coupling of the Ala to the nascent polypeptide chain and is an essential part of the SsrA peptide tagging system. SmpB has been associated with the survival of bacterial pathogens in conditions of stress. It is universal in the first 100 sequenced bacterial genomes. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 129194
View PSSM: TIGR00086
Aligned: 18 rows
Threshold Bit Score: 163.941
Threshold Setting Gi: 3334331
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O25985   3 LIASNKKAYFDYEILETLEAGLALLGSEVKALRQTRVNLKDNFVKIIKGEAFLFGVHISyLDTIHAYYKPNERRERKLLL 82  Helicobacter pylori 2...
O32881  11 IVATNRKARHDYAIIELFEAGVALLGTEVKSLREGHASLADAFATVDSGEVWLRNMHIP-EYQHGSWTNHDPRRNRKLLL 89  Mycobacterium leprae TN
Q83N13  26 VIASNKSAEYNYFLDKTFEAGLVLLGSEVKSVRQQKISLSEAYIYEDNSEIWLANLYIP-EHKTGGWTNHNPRRLRKLLL 104 Tropheryma whipplei s...
O84079   5 EIVSNRKAFHHYEVLETLDAGIVLTGTEIKSLRDHGGNLGDAYVTISKGEAWLLQSSIA-LYRFGNINNHEERRKRKLLL 83  Chlamydia trachomatis...
P75043   3 VLVNNPRAQYDYYLLTGYCAGLVLKGSEVKSLALGQGSLKEAYVFIDKHEVYIKDFSIS-PYAFSGEFNHPFKRVKKLLL 81  Mycoplasma pneumoniae...
Q8RFS8   2 IIANNKKAFFDYFIEEKYEAGIELKGSEVKSIKAGKVSIKEAFVRIINDEIFIMGMSVV-PWEFGSVYNPEERRVRKLLL 80  Fusobacterium nucleat...
Q8ABD1   6 VNIKNKRATFDYELMDTYTAGIVLTGTEIKSIRLGKASLVDTFCYFAKGELWVKNMHIA-EYFYGSYNNHTARRDRKLLL 84  Bacteroides thetaiota...
Q98QK9   4 LITKNKQVFRDYEIIDKLEAGIVLQGWEVKSIRASDVNLKGSYCVFKANELYLINSYIGlYMAV----KGDERQSRKLLL 79  Mycoplasma pulmonis U...
Q9X498   3 IISDNKRGMHNYKVIDKYEAGISLMGWEVKSARANTVSLLNSYCFFRKGEIFLCNAQFKqYMLV----KCDETRDRKLLM 78  Mycoplasma fermentans...
P44967  12 TIALNKRARHDYFIEDEIEAGLELQGWEVKSMRAGKANISDSYVIFKNGEAFLFGASIQpLNVASTHIVCDPTRTRKLLL 91  Haemophilus influenza...
O25985  83 HKKQLLKWQIEASKE-RLSIVGLKLYFNQRNRAKIQIALVKGKRLHDKRQSLKEKALNKEILADLK 147 Helicobacter pylori 26695
O32881  90 HRRQIDTLVGKIRDG-NLALVPLSLYFAE-GKVKVELALARGKKLHDKRQDMARRDAQREVIRELG 153 Mycobacterium leprae TN
Q83N13 105 HKYQIARLRKDLLIP-GITLVPIKFYFRN-GRAKLLIALARGKKLIDKREVIKEREATLEANRALK 168 Tropheryma whipplei str. Twist
O84079  84 HKYEIHKLDARISQK-GLTVVPLSFFFS-KGFVKVRIGCCRGKKAHDKRQSIIEREKNRELAAAMK 147 Chlamydia trachomatis D/UW-3/CX
P75043  82 NRNEIKQITARQKQE-GLSIIPLKVFFK-NGKIKMEIWLAKPKKKFDKREAIKSKTIQRELRQQYG 145 Mycoplasma pneumoniae M129
Q8RFS8  81 HRKEIKKIHEKVKIK-GYTIVPLDVHLS-KGYVKMQIAIAKGKKTYDKRESIAKKDQERNLKREFK 144 Fusobacterium nucleatum subsp. nucl...
Q8ABD1  85 NKKELEKIQRGMKDP-GFTTVPVRLFINEKGLAKLVVALAKGKKQYDKRESIKEKDDRRDMARMFK 149 Bacteroides thetaiotaomicron VPI-5482
Q98QK9  80 HKNQLRRLKQKVESQ-SLSIVPLSLYWNKKSKVKAEIALVRGLKKHDKREKLKKEETNKKLKKLIS 144 Mycoplasma pulmonis UAB CTIP
Q9X498  79 HKNEIVRLQSKLHKLgHATIIPSKIYFDNRSRIKIEIALVQGMKKTDKREEIKKRDNERYIKKVLK 144 Mycoplasma fermentans PG18
P44967  92 NKRELASLFGKANRD-GFTIVALSLYWK-SAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMK 155 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap