1PA4,1JOS


Conserved Protein Domain Family
rbfA

?
TIGR00082: rbfA 
Click on image for an interactive view with Cn3D
ribosome-binding factor A
Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S rRNA. Mutants lacking rbfA have a cold-sensitive phenotype. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 129191
View PSSM: TIGR00082
Aligned: 10 rows
Threshold Bit Score: 117.859
Threshold Setting Gi: 20978572
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PA4_A         1 MaSY--KKERLENDIIRLINRTVIHE-IYNETV--KT-GHVTHVKLSDDLLHVTVYLDCY---N--REQIDRVVGAFNQA 69  Mycoplasma pneu...
P32731         1 M-SM--RANRVGEQMKKELGDIISRK-LKDPRI--GF-LTVTDVRVSGDLQIAKVYISVLg--D--EKKREEALKGLAKA 69  Bacillus subtil...
Q55625         1 MaTSr-RVSRVSSLIKREVSQMLLHE-IKDDRVgtGM-VSVTEVEVSGDLQHAKIFVSIYg--S--PEAKASTMAGLHSA 73  Synechocystis s...
P47389         1 MaSY--RKQRIENDIIRLINRTIINE-IYDPVV--KL-GHVSHVKLSADFFHAVVYLDCY---D--RSQIQTVVNAFKKA 69  Mycoplasma geni...
P75589         1 MaSY--KKERLENDIIRLINRTVIHE-IYNETV--KT-GHVTHVKLSDDLLHVTVYLDCY---N--REQIDRVVGAFNQA 69  Mycoplasma pneu...
O25688         1 MnAH---KERLESNLLELLQEALAS--LNDSEL--NS-LSVTKVECSKGKHHAYVFVL---------SSDHKILSKLKKA 63  Helicobacter py...
P45141         1 MaREfkRSDRVAQEIQKEIAVILQRE-VKDPRI--GM-VTVSDVEVSSDLSYAKIFVTFLf--DhdEMAIEQGMKGLEKA 74  Haemophilus inf...
ESU82207      40 MaKEfgRPQRVAQEMQKEIALILQRE-IKDPRL--GMmTTVSGVEMSRDLAYAKVYVTFLndkD--EDAVKAGIKALQEA 114 Shigella dysent...
1JOS_A         1 MaREfkRSDRVAQEIQKEIAVILQRE-VKDPRI--GM-VTVSDVEVSSDLSYAKIFVTFLf--DhdEMAIEQGMKGLEKA 74  Haemophilus inf...
WP_002657228   1 -mykniKKFKLESFIAQEIGNLIVSGgIKDPRIh-SF-LTVVKVEFSKDLINAKVFMGSIk--E--GASLDNAVKALNNA 73  Lyme disease sp...
1PA4_A        70 KGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAMRIESIINSLKKS 113 Mycoplasma pneumoniae
P32731        70 KGFIRSEIGSRIRLRKTPEIEFEFDESIDYGNRIETLIHELHSE 113 Bacillus subtilis subsp. subtilis str. 168
Q55625        74 APFVRRELGQRMRLRRTPEVSFLEDRSLERGDKILNLLNNLPQA 117 Synechocystis sp. PCC 6803 substr. Kazusa
P47389        70 QGVFSQMLAQNLYLAKSVKLHFVKDDAIDNALKIEQIINSLKN- 112 Mycoplasma genitalium G37
P75589        70 KGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAMRIESIINSLKKS 113 Mycoplasma pneumoniae M129
O25688        64 EGLIRQFVLQASGWFKCPKLSFVSDNSLEKQLRLDAIFNEIAKG 107 Helicobacter pylori 26695
P45141        75 SPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVRE 118 Haemophilus influenzae Rd KW20
ESU82207     115 SGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKH 158 Shigella dysenteriae WRSd3
1JOS_A        75 SPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGMRMSNLVTNVVRE 118 Haemophilus influenzae
WP_002657228  74 KGFIQSQIIKRIKVRSTPKLLFVKDDSLSKSFYVNKLIEGLNTT 117 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap