Conserved Protein Domain Family

TIGR00082: rbfA 
Click on image for an interactive view with Cn3D
ribosome-binding factor A
Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S rRNA. Mutants lacking rbfA have a cold-sensitive phenotype. [Transcription, RNA processing]
PSSM-Id: 129191
Aligned: 10 rows
Threshold Bit Score: 117.859
Threshold Setting Gi: 20978572
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P32731        70 KGFIRSEIGSRIRLRKTPEIEFEFDESIDYGNRIETLIHELHSE 113 Bacillus subtilis subsp. subtilis str. 168
Q55625        74 APFVRRELGQRMRLRRTPEVSFLEDRSLERGDKILNLLNNLPQA 117 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap