2E0W


Conserved Protein Domain Family
g_glut_trans

?
TIGR00066: g_glut_trans 
Click on image for an interactive view with Cn3D
gamma-glutamyltranspeptidase
Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 129176
View PSSM: TIGR00066
Aligned: 7 rows
Threshold Bit Score: 694.976
Threshold Setting Gi: 596034
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2E0W_A        25 GMVASVDATAT---------QVGVDILKE-GGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRS-KNGNTTAIDFREMA 93  Escherichia col...
P18956        49 GMVASVDATAT---------QVGVDILKE-GGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRS-KNGNTTAIDFREMA 117 Escherichia col...
P54422        47 GMVATAHPLAS---------EIGADVLKK-GGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDgKTKDTTIIDSRERA 116 Bacillus subtil...
P74181         7 GVVAAGHAQTA---------EAGKCMLEE-GGNAFDAAIASVLAACVVESSLTSLGGGGFLLAQT-AAKKSYLFDFFCQT 75  Synechocystis s...
WP_001254471  38 GLALSSHPLAS---------EIGQKVLEE-GGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHL-ANGENVALDFREKA 106 Helicobacter py...
AAB67344     101 LLKVGLHGAISsdlevcsnlTINEVLLKFpGSNAADAAVTQALCKGMVNFFNSGIGGGGYVVFSGkDDEDHLSIDFREKA 180 baker's yeast
WP_003227847  10 QMVVSPHYLAS---------QAGNRILDK-GGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHqETKAVKVYNGSGRS 79  Bacillus subtilis
2E0W_A        94 PAKATRDMFLDDQGNPDSKksl-----tsHLASGTPGTVAGFSLALDKYG--TMPLNKVVQPAFKLARDGFIVNDALADD 166 Escherichia col...
P18956       118 PAKATRDMFLDDQGNPDSKksl-----tsHLASGTPGTVAGFSLALDKYG--TMPLNKVVQPAFKLARDGFIVNDALADD 190 Escherichia col...
P54422       117 PAGATPDMFLDENGKAIPFser----vtkGTAVGVPGTLKGLEEALDKWG--TRSMKQLITPSIKLAEKGFPIDSVLAEA 190 Bacillus subtil...
P74181        76 PQVNPGEKAVDFYPVALNFggawqtfhigKGAIAVPGMVAGLFAAHRKLG--QLPFKVLIEPAVAYARQGFTLN-RFNDF 152 Synechocystis s...
WP_001254471 107 PLKATKNMFLDKQGNVVPKlse-----dgYLAAGVPGTVAGMEAMLKKYG--TKKLSQLIDPAIKLAENGYAISQRQAET 179 Helicobacter py...
AAB67344     181 PMDSHKFMFENCSLCSKIG----------GLAVGVPGELMGLYRLFKERGsgQVDWRDLIEPVAKLGSVGWQIGEALGAT 250 baker's yeast
WP_003227847  80 GKNVTRDVYKGKSAIPLRGi---------DSAITVPGMVDSWDAVLKEYG--RLSLADVLEPARDYAQNGFPVSADQCRH 148 Bacillus subtilis
2E0W_A       167 LKTYGSEVLPNHENSKAIFWKEGE-PLKKGDTLVQANLAKSLEMIAENG-PDEFYKGT--IAEQIAQEMQKNGGLITKED 242 Escherichia col...
P18956       191 LKTYGSEVLPNHENSKAIFWKEGE-PLKKGDTLVQANLAKSLEMIAENG-PDEFYKGT--IAEQIAQEMQKNGGLITKED 266 Escherichia col...
P54422       191 ISDYQEKLSRTA--AKDVFLPNGE-PLKEGDTLIQKDLAKTFKLIRSKG-TDAFYKGK--FAKTLSDTVQDFGGSMTEKD 264 Bacillus subtil...
P74181       153 TNGLLEPILTQQEEGRKFYAPQGK-ILRQGEKAYLPQFADVLEQLARHG-PDWFYRGE--LTEWVLESLGEAS-ALTAKD 227 Synechocystis s...
WP_001254471 180 LKEARERFLKYS-SSKKYFFKKGHlDYQEGDLFVQKDLAKTLNQIKTLG-AKGFYQGQ--VAELIEKDMKKNGGIITKED 255 Helicobacter py...
AAB67344     251 LELYEDVFLTLKEDWSFVLNSTHDgVLKEGDWIKRPALSNMLMELAKNGsVAPFYDPDhwIAKSMIDTVAKYNGIMNLQD 330 baker's yeast
WP_003227847 149 TEKNIELLASTP-YTADIFTRRGKaPV-PGERFVQKELADSLNLIAEKG-RSAFYEGD--LAQRIVSHLQNNGSYMTIDD 223 Bacillus subtilis
2E0W_A       243 LAAYKAVERTPISGDYRG--------YQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRS 314 Escherichia col...
P18956       267 LAAYKAVERTPISGDYRG--------YQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRS 338 Escherichia col...
P54422       265 LENYDITIDEPIWGDYQG--------YQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRA 336 Bacillus subtil...
P74181       228 WADYQVEIRLPLRAQYRQ--------RQLLTNPPPSAGGILIAFALQLLEKYDLSQYPLGSAAQIQLFSQVMALSNQARR 299 Synechocystis s...
WP_001254471 256 LASYNVKWRKPVVGSYRG--------YKIISMSPPSSGGTHLIQILNVMENADLSALGYGASKNIHIAAEAMRQAYADRS 327 Helicobacter py...
AAB67344     331 VSSYDVHVTKPLSMKIRKganfipdnDMTVLTSSGSSSGAALLAALRIMDNFQNQEGGDYEKETTYHLLESMKWMASARS 410 baker's yeast
WP_003227847 224 FKAHRGEWAAPVSSDYRG--------YSVYQAPP-NSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRD 294 Bacillus subtilis
2E0W_A       315 EYL-GDPDFVKVPWQALTNKAYAKSIADQIDINKAK--PSS----EIRPG------KLAPYE--SNQATHYSVVDKDGNA 379 Escherichia col...
P18956       339 EYL-GDPDFVKVPWQALTNKAYAKSIADQIDINKAK--PSS----EIRPG------KLAPYE--SNQTTHYSVVDKDGNA 403 Escherichia col...
P54422       337 SYA-GDPEFVNVPLKGLLHPDYIKERQQLINLDQVNkkPKAgdpwKYQEGsanykqVEQPKDkvEGQTTHFTVADRWGNV 415 Bacillus subtil...
P74181       300 QYLdGNLHCGDIEAKFLGGDRLASELGQSKFINKLG------------------------------STTHISVLDGEGNA 349 Synechocystis s...
WP_001254471 328 VYM-GDADFVSVPVDKLINKAYAKKIFDTIQPDTVT--PSS----QIKPG------MGQLHE--GSNTTHYSVADRWGNA 392 Helicobacter py...
AAB67344     411 RLGdFEGEALPKHIEEVLDPEWALKAVKSIKRNSQDgnFKTlenwTLYDP------AYDINN--PHGTAHFSIVDSHGNA 482 baker's yeast
WP_003227847 295 AVL-TDPAFADIPLERLLDKRYAKQLAEEIGYLAI-------------PA------ESRPV---GSDTAYAAVIDADGNA 351 Bacillus subtilis
2E0W_A       380 VAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAKPgvpnvyglvgG--------D----------ANAVGPNKRPLSSMS 441 Escherichia col...
P18956       404 VAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAKP----------GvpnvyglvGg--------dANAVGPNKRPLSSMS 465 Escherichia col...
P54422       416 VSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIP----------G--------G----------ANEVQPNKRPLSSMT 467 Bacillus subtil...
P74181       350 ASLTSS-NGE-GSGHFIPGTGIMLNNMLGEEDLNP----------Q--------G----------FYQWPPGQRLSSMMA 399 Synechocystis s...
WP_001254471 393 VSVTYTINASYGSAASIDGAGFLLNNEMDDFSIKP----------G--------NpnlyglvggdANAIEANKRPLSSMS 454 Helicobacter py...
AAB67344     483 VSLTTTINLLFGSLVHDPKTGVIFNNEMDDFAQFN----------Ksnsf-elaPs--------iYNFPEPGKRPLSSTA 543 baker's yeast
WP_003227847 352 VSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDE----------N--------H----------VNTLEPRKRTFHTLM 403 Bacillus subtilis
2E0W_A       442 PTIVVKDG-KTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP----DELRVEK--GFSPDTLKLLE 514 Escherichia col...
P18956       466 PTIVVKDG-KTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP----DELRVEK--GFSPDTLKLLE 538 Escherichia col...
P54422       468 PTILFKDD-KPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM-----SSYRYED--GVPKDVLSKLN 539 Bacillus subtil...
P74181       400 PTILLDQE-QPRLVLGSGGSNRIRSAILQVVCHHLDYQLPLAEAVGRERIHWEAH------KLDLEPt-SVADILAQLRF 471 Synechocystis s...
WP_001254471 455 PTIVLKNN-KVFLVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP----DELRIEKf-GMPADVKDNLT 528 Helicobacter py...
AAB67344     544 PTIVLSELgIPDLVVGASGGSRITTSVLQTIVRTYWYNMPILETIAYPRIHHQLLP----DRIELESfpMIGKAVLSTLK 619 baker's yeast
WP_003227847 404 PAMVCKGG-KPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWgeeyEGLRVEG--RFTDKTIQKLK 480 Bacillus subtilis
2E0W_A       515 AKGqkVALKEA----MGSTQSIMVGPDGEl---YGASD-PR 547 Escherichia coli K-12
P18956       539 AKGqkVALKEA----MGSTQSIMVGPDGEl---YGASD-PR 571 Escherichia coli K-12
P54422       540 GMGhkFGTSPVd---IGNVQSISIDHENGt--fKGVADsSR 575 Bacillus subtilis subsp. subtilis str. 168
P74181       472 DDGtqGTLWTEqnmfFGGVHGVATTTAGTm---EGVGD-PR 508 Synechocystis sp. PCC 6803 substr. Kazusa
WP_001254471 529 KMGyqIVTKPV----MGDVNAIQVLPKTKgsvfYGSTD-PR 564 Helicobacter pylori
AAB67344     620 EMG--YTMKEVf--pKSVVNAIRNVRGEW----HAVSDyWR 652 baker's yeast
WP_003227847 481 DSGhlVEVVGDydplMGQAAAIKVDEEGFl---QGGAD-PR 517 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap