1GTP


Conserved Protein Domain Family
folE

?
TIGR00063: folE 
Click on image for an interactive view with Cn3D
GTP cyclohydrolase I
alternate names: Punch (Drosophila),GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid]
Statistics
?
PSSM-Id: 129173
View PSSM: TIGR00063
Aligned: 7 rows
Threshold Bit Score: 298.21
Threshold Setting Gi: 606997305
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GTP_A    39 IAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVdEIFSGLDYANF-PKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI 117 Escherichia coli
Q55759    50 MMDAVRVMLESVGEDPEREGLLKTPKRVAEAMQ-FLTQGYDQSLE-KLVNGAIFDEGHNEMVLVRDIDFFSLCEHHMLPF 127 Synechocystis sp. P...
P51601    61 ISGAIKTILTELGEDVNREGLLDTPQRYAKAML-YFTKGYQTNIMdDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPF 139 Saccharomyces cerev...
P19465     9 IEQAVRQILEAIGEDPNREGLLDTPKRVAKMYA-EVFSGLNE-DP-KEHFQTIFGENHEELVLVKDIAFHSMCEHHLVPF 85  Bacillus subtilis s...
P56462     1 MENFFNQFFESIGEDKNREGLKETPKRVQELWK-FLYKGYKEDPR-VALKSAYFQGVCDEMIVAQNIEFYSTCEHHLLPF 78  Helicobacter pylori...
EZA26242  40 IAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVdEIFSGLDYANF-PKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI 118 Escherichia coli O2...
P43866    38 IAKHMHEVMKLIGLDLRDDSLEETPNRLAKMFIdEIFSGMDYANF-PKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTI 116 Haemophilus influen...
1GTP_A   118 DGKATVAYIPKD-SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTT 196 Escherichia coli
Q55759   128 MGKAHLAYIPNQ-KVVGLSKLARIVEMFSRRLQVQERLTRQIAEAVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVT 206 Synechocystis sp. P...
P51601   140 FGKVHIGYIPNK-KVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVT 218 Saccharomyces cerev...
P19465    86 YGKAHVAYIPRGgKVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVT 165 Bacillus subtilis s...
P56462    79 LGNISVGYIPKE-KIVGISAIAKLIEIYSRRLQIQERLTIQIAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKT 157 Helicobacter pylori...
EZA26242 119 DGKATVAYIPKD-SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTT 197 Escherichia coli O2...
P43866   117 DGKVCVAYYPKD-WVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVT 195 Haemophilus influen...
1GTP_A   197 TSLGGLFKSSQNTRHEFLRAVRH 219 Escherichia coli
Q55759   207 SAMIGSFQNEQKTREEFLNLIRH 229 Synechocystis sp. PCC 6803 substr. Kazusa
P51601   219 SCMLGGFRAH-KTREEFLTLLGR 240 Saccharomyces cerevisiae S288c
P19465   166 SAVRGVFKDDAAARAEVLEHIKR 188 Bacillus subtilis subsp. subtilis str. 168
P56462   158 SVLRGLFKKDSKTRAEFMQLLKS 180 Helicobacter pylori 26695
EZA26242 198 TSLGGLFKSSQNTRHEFLRAVRH 220 Escherichia coli O28ac:NM str. 02-3404
P43866   196 SAYGGVFLEDRDTRKEFLATVQK 218 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap