1HRB


Conserved Protein Domain Family
Hemerythrin

?
TIGR00058: Hemerythrin 
Click on image for an interactive view with Cn3D
hemerythrin family non-heme iron protein
This family includes oxygen carrier proteins of various oligomeric states from the vascular fluid (hemerythrin) and muscle (myohemerythrin) of some marine invertebrates. Each unit binds 2 non-heme Fe using 5 H, one E and one D. One member of this family,from the sandworm Nereis diversicolor, is an unusual (non-metallothionein) cadmium-binding protein. Homologous proteins, excluded from this narrowly defined family, are found in archaea and bacteria (see pfam01814).
Statistics
?
PSSM-Id: 129168
View PSSM: TIGR00058
Aligned: 7 rows
Threshold Bit Score: 166.086
Threshold Setting Gi: 21263696
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HRB_A     4 IPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDN-ADNLGELRRCTGKHFLNQEVLMEA-SQYQ-FYDEHKKEHDGF 80  Phascolopsis gouldii
P27686     4 IPEPYVWDESFRVFYDNLDDEHKGLFKGVFNCAADMSsAGNLKHLIDVTTTHFRNEEAMMDA-AKYE-NVVPHKQMHKDF 81  Phascolopsis gouldii
P22761     4 VPEPFKWDESFQVFYDKLDEEHKQIFNAIFALGGGNN-ADNLKKMIDVTANHFADEEAMMLAsAAYKsEHPGHKKKHEDF 82  Hediste diversicolor
AAS49167   5 IPEPYVWDESFKVFYENLDEEHKGLFQAIFNLSKSPAdNGALKHLSKVIDEHFSHEEDMMKK-ASYS-DFDNHKKAHVDF 82  medicinal leech
P22766     4 VPDPFIWDASFKTFYDDLDNQHKQLFQAILTQGNVGG-ATAGDNAYACLVAHFLFEEAAMQV-AKYG-GYGAHKAAHEEF 80  Siphonosoma cumanense
2022172B   3 VPAPYAWNSDFATTYENIDSEHRTLFNGLFALAEFNT-LTQLNAAIEVFTLHFHDEQGQMIR-SNYV-NTKEHTDIHNGF 79  Lingula reevii
Q9NH76     5 IPSPFNWDSSFCVGNNELNEQHKKLFALINALDANRSsASALKELLDFVVMHFKAEEDLFAK-VNFS-DSTSHKETHDKF 82  Naegleria fowleri
1HRB_A    81 INALDNWKG-----DVKWAKAWLVNHIKTIDFKYKGKI 113 Phascolopsis gouldii
P27686    82 LAKLGGLKApldqgTIDYAKDWLVQHIKTTDFKYKGKL 119 Phascolopsis gouldii
P22761    83 LAVIRGLSApvpndKLLYAKDWLVNHIKGTDFTYKGKL 120 Hediste diversicolor
AAS49167  83 QASLGGLSSpvandKVHWAKDWLVNHIKGTDFLYKGKL 120 medicinal leech
P22766    81 LGKVKGGSA-----DAAYCKDWLTQHIKTIDFKYKGKL 113 Siphonosoma cumanense
2022172B  80 MDVMRGWRSpvpqqDLLAGMAWLANHIPTEDFKYKGKL 117 Lingula reevii
Q9NH76    83 VQDALGLKTvg-daEIQFIKQWLVNHIKGSDMKYKGVL 119 Naegleria fowleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap