Conserved Protein Domain Family
TIGR00056

?
TIGR00056: TIGR00056 
ABC transport permease subunit
This model describes a subfamily of ABC transporter permease subunits. One member of this family has been associated with the toluene tolerance phenotype of Pseudomonas putida, another with L-glutamate transport, another with maintenance of lipid asymmetry. Many bacterial species have one or two members. The Mycobacteria have large paralogous families included in the DUF140 family but excluded from this subfamily on based on extreme divergence at the amino end and on phylogenetic and UPGMA trees on the more conserved regions. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129166
View PSSM: TIGR00056
Aligned: 7 rows
Threshold Bit Score: 290.421
Threshold Setting Gi: 499183452
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45030         1 MIVN-FISALGKQVIDFFR----ALGRAGFMLFGALIGKPQIRKhFPL--------LVKQMHVLGVQSLLIILLSGLFIG 67  Haemophilus inf...
P45392         1 MLLN-ALASLGHKGIKTLR----TFGRAGLMLFNALVGKPEFRKhAPL--------LVRQLYNVGVLSMLIIVVSGVFIG 67  Escherichia coli
WP_010872784  18 MTQSiILAELSSWLRRSGQ----AILLLGNTSFQLFTGKIDGRN------------TTQQLMFVGPASLPITLITAAVIG 81  Synechocystis s...
WP_000845765 111 KHYElLITKLGKSIVETYNtflnAFNFCGMILFYFIKSVFNPKR-FCIt------pLLYHINESGFKVLPVSILTVFIVG 183 Helicobacter py...
WP_010871657   1 MSDRgSRHSLSLWFQRLVA----AFFLTGQVFLHILQGRINRRN------------TLEQMNMVGPESMAIALITAGFVG 64  Synechocystis s...
WP_010880992  72 IKLVlDNLKLPKEIPEKKV----SFSLKNLFSFPEFLGLFLIHS-FKYikqfefsaFFKELQTSGLGSVLILVSLSFLIG 146 Aquifex aeolicus
WP_010880179   1 ---------MTKFLEEVGR----ATLLTLWSIFFLFKKPPRLKH------------FISQLTYVAAETTPVVLVTSLFTG 55  Aquifex aeolicus
P45030        68 MVLGLQGYVVLIDFSAETSLGQLVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPR 147 Haemophilus inf...
P45392        68 MVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEIGLMRATEQLSSMEMMAVDPLRRVISPR 147 Escherichia coli
WP_010872784  82 MIFTIQVAREFLAFGAGSAVGGILMLALGRELCPIMTAVVVAGRVGSAFAAEIGTMRVTEQIDALYMLNTNPVEYLVIPR 161 Synechocystis s...
WP_000845765 184 FAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPR 263 Helicobacter py...
WP_010871657  65 MVFTIQVAREFIYYGATTTIGGVLSLSLTRELAPVLTAVVIAGRVGSAFAAEIGTMRVTEQLDALYMLRTDPIDYLVVPR 144 Synechocystis s...
WP_010880992 147 VVIAYQSAVQLRAFGAGIFIVDLVGISTFRELAPLLTGIILAGRVSSGYTANVGLRKINEEIDALRVMGLSPVVLLVLPR 226 Aquifex aeolicus
WP_010880179  56 GVIALQTYSTFHRFNAEYLIGAVVAISMGRELGPVLTSLMVVARVGSAMTASIGTMRITQQIDALEVMAINPISFLVTPR 135 Aquifex aeolicus
P45030       148 FWAGVISMPVLSILFIAIGIWGGSLVGVDWKGVDSGSFWSVMQNSVS-WsyDILNGFIKAVFFAVAVTWIALFNGYDCMP 226 Haemophilus inf...
P45392       148 FWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGIDSGFFWSAMQNAVD-WrmDLVNCLIKSVVFAITVTWISLFNGYDAIP 226 Escherichia coli
WP_010872784 162 LLACCIMVPTLSVLALVTGMMGGAVISSNVYGIANQVFFESIQTFVTpW--DIFCGPVKGIVFGVLIAIIGCNWGLTTRG 239 Synechocystis s...
WP_000845765 264 VLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFHDTVGwN--HFLVGIVKAPFWGFAIAMVGCMRGFEVKG 341 Helicobacter py...
WP_010871657 145 VIACGLMLPILTGLSLFVGMAGGLVISSSLYAINPTIFLNSVQNFTQlW--DVFACLFKSLVFGVIIAIIGCSWGLTTTG 222 Synechocystis s...
WP_010880992 227 VLASLIYTPLLTSLSAVAMLLGGAIIAQVFLGIGVEEFFKKLPEAVAkE--DLFAGYVKTPFFGVAIALNGVYYGFLTDP 304 Aquifex aeolicus
WP_010880179 136 IFATTFGVPLLTVLSDVAGIFGGWFVATKLFGVNEYLYWQKMVDLTEfH--DIVGGLYKATFFGFIIGAVSCYYGFYTKG 213 Aquifex aeolicus
P45030       227 TSEGISQATTRTVVHASLVVLGLDFILTAIMF-GA 260 Haemophilus influenzae Rd KW20
P45392       227 TSAGISRATTRTVVHSSLAVLGLDFVLTALMF-GN 260 Escherichia coli
WP_010872784 240 GAKGVGESTTAAVVTSLLAIFVSNFLMSWIMFqGS 274 Synechocystis sp. PCC 6803
WP_000845765 342 DTESIGRLTTISVVNALFWIIFLDAIFSIIFSkln 376 Helicobacter pylori
WP_010871657 223 GAKGVGESTTTAVVTSLLAIFISNFFLSWLMFqGT 257 Synechocystis sp. PCC 6803
WP_010880992 305 KPESLGYSVMRSVVTGISVIILLDAVFSIIFLrlg 339 Aquifex aeolicus
WP_010880179 214 GTAGVGKATTNSVVTSSMLILISDYFLTAVIF--- 245 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap