1UEH,2D2R


Conserved Protein Domain Family
uppS

?
TIGR00055: uppS 
Click on image for an interactive view with Cn3D
undecaprenyl diphosphate synthase
This enzyme builds undecaprenyl diphosphate, a molecule that in bacteria is used a carrier in synthesizing cell wall components. Alternate name: undecaprenyl pyrophosphate synthetase. Activity has been demonstrated experimentally for members of this family from Micrococcus luteus, E. coli, Haemophilus influenzae, and Streptococcus pneumoniae. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129165
View PSSM: TIGR00055
Aligned: 9 rows
Threshold Bit Score: 319.349
Threshold Setting Gi: 465535
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UEH_A  19 RHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALD---- 94  Shigella flexneri
Q47675  19 RHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALD---- 94  Escherichia coli
P44938  11 KHVAIIMDGNGRWAKQKNKMRIFGHTNGVTAVRKAVAYARQIGVEVLTLYAFSSENWSRPEQEISALMSLFMQALD---- 86  Haemophilus influenza...
Q58767  50 khvaiiMDGNRRAAEIYGKDRYYGHYLGAEKVREVLRWARDLGINVVTLYAFSTENFRRPKEEVDKLMELFEKKFYeiad 129 Methanocaldococcus ja...
P55984   6 KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLK---- 81  Helicobacter pylori 2...
P35196  33 RHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDTATVFAFSIENFKRSSREVESLMTLARERIRqite 112 Saccharomyces cerevis...
Q55482  22 QHVAVIMDGNGRWAKQRGMPRIMGHQRGVDSLKNLLRCCDDWGIAALTAYAFSTENWGRPLEEVEFLMTLFERVLR---- 97  Synechocystis sp. PCC...
Q03175  68 EHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDefak 147 Saccharomyces cerevis...
2D2R_A  17 KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLK---- 92  Helicobacter pylori
1UEH_A  95 SEVKSLHR-HNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQID 173 Shigella flexneri
Q47675  95 SEVKSLHR-HNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQID 173 Escherichia coli
P44938  87 REVKKLHK-NNICLKIIGDVSRFSETLQEKIKKAENLTEKNTALTLNIAANYGGCWDIIQAAKQIAEKVKKEEMSVSDIN 165 Haemophilus influenza...
Q58767 130 DE--EIHR-YEVRVRAIGRINLLPKNVQKAIKYAEERTKNYNKFFVNIAIAYGGQQEIIDAVKKIAEKVKRGEIEPEDID 206 Methanocaldococcus ja...
P55984  82 DERSTYLN-NNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESPPSHINLLESLE 160 Helicobacter pylori 2...
P35196 113 RGELAC-K-YGVRIKIIGDLSLLDKSLLEDVRVAVETTKNNKRATLNICFPYTGREEILHAMKETIVQHKKGAA----ID 186 Saccharomyces cerevis...
Q55482  98 RELKEMMA-ENVRIRFVGNLTSLPRSLQDEIARSMEDTKNNTGIRFTVATNYGGRQEIVHVCQAIAREVQSGKLDPETID 176 Synechocystis sp. PCC...
Q03175 148 RAKDYKDPlYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVEDHLENKSPRINIR 227 Saccharomyces cerevis...
2D2R_A  93 DERSTYLD-NNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESPPSNISLLESLE 171 Helicobacter pylori
1UEH_A 174 EEMLNQHVCmHELA-P-VDLVIRTGGEHRISNFLLWQIAY-AE-LYFTDVLWPDFDEQDFEGALNAFANrERRFG 244 Shigella flexneri
Q47675 174 EEMLNQHVCmHELA-P-VDLVIRTGGEHRISNFLLWQIAY-AE-LYFTDVLWPDFDEQDFEGALNAFANrERRFG 244 Escherichia coli
P44938 166 NSTFQHHLAtQNAP-P-VDLLIRTSGEQRISNFLLWQIAY-AE-LYFSDVLWPDFNQLEFNRAIASYQQrHRRFG 236 Haemophilus influenzae Rd ...
Q58767 207 KELIDKHLYtANLPfPnPDLIIRTSGEERISNFLIWQSSY-SE-LYFCDIYWPLFRRVDFLRAVRDYQRrQRRFG 279 Methanocaldococcus jannasc...
P55984 161 NEISNRLDT-HDLP-E-VDLLLRTGGEMRLSNFLLWQSSY-AE-LFFTPILWPDFTPKDLENIISDFYKrVRKFG 230 Helicobacter pylori 26695
P35196 187 ESTLESHLYtAGVP-P-LDLLIRTSGVSRLSDFLIWQASSkGVrIELLDCLWPEFGPIRMAWILLKFSF-HKSFL 258 Saccharomyces cerevisiae S...
Q55482 177 EGVVEKYLYtEGLS-H-PDLLIRTSGELRISNFLLWQMAY-AE-IYVTSTLWPDFDRQAFHLALRDYQQrHRRFG 247 Synechocystis sp. PCC 6803...
Q03175 228 KFTNKMYMG-FHSN-K-CELLIRTSGHRRLSDYMLWQVHEnAT-IEFSDTLWPNFSFFAMYLMILKWSF-FSTIQ 297 Saccharomyces cerevisiae S...
2D2R_A 172 NEISNRLDt-RNLP-E-VDLLLRTGGEMRLSNFLLWQSSY-AE-LFFTPILWPDFTPKDLENIISDFYKrVRKFG 241 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap