1G0S,3O52


Conserved Protein Domain Family
TIGR00052

?
TIGR00052: TIGR00052 
Click on image for an interactive view with Cn3D
nudix-type nucleoside diphosphatase, YffH/AdpP family
Members of this family include proteins of about 200 amino acids, including the recently characterized nudix hydrolase YffH, shows to be highly active as a GDP-mannose pyrophosphatase. It also includes the C-terminal half of a 361-amino acid protein, TrgB from Rhodobacter sphaeroides, shown experimentally to help confer tellurite resistance. This model also hits a region near the C-terminus of a 1092-amino acid protein of C. elegans. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129162
View PSSM: TIGR00052
Aligned: 6 rows
Threshold Bit Score: 268.613
Threshold Setting Gi: 446042123
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G0S_A        14 NDVEIIARETLYRGFFSLDLYRFRHRLFNGQMSHEVRREIFERGHAAVLLPFDPVRDEVVLIEQIRIAAYDTSET---PW 90  Escherichia col...
P37128         2 TQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNTKKKTVVLIRQFRVATWVNGNE---SG 78  Escherichia col...
P36651        14 NDVEIIARETLYRGFFSLDLYRFRHRLFNGQMSHEVRREIFERGHAAVLLPFDPVRDEVVLIEQIRIAAYDTSET---PW 90  Escherichia coli
WP_000119978   9 NQKSLIDDSSVYLEPCSSSNFIELKRMHYNEENTKKTWDIIKSLDSVAVLLYEKESDCFVIVKQFRPAIYARRFHfkcDQ 88  Helicobacter py...
P44684        17 QDIEILGEQTLYEGFFTLKRIQFKHKLFAGGQSGVVTRELLIKGAASAVIAYDPKEDSVILVEQVRIGAAYHPEShrsPW 96  Haemophilus inf...
3O52_A         2 TQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNTKKKTVVLIRQFRVATWVNGNE---SG 78  Escherichia col...
1G0S_A        91 LL-------EMVAGMIEEG-ESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLA 160 Escherichia col...
P37128        79 QL-------IESCAGLLDN-DEPEVCIRKEAIEETGYEV--GEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGGV 148 Escherichia col...
P36651        91 LL-------EMVAGMIEEG-ESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLA 160 Escherichia coli
WP_000119978  89 DQtidgytyELCAGLVDKAnKSLEEIACEEALEECGYQIspKNLETIGQFYSATGLSGSLQTLYYAEVHKNLKVSKGGGI 168 Helicobacter py...
P44684        97 LL-------ELIAGMVEKG-EKPEDVALRESEEEAGIQV--KNLTHCLSVWDSPGGIVERIHLFAGEVDSAQAKGIHGLA 166 Haemophilus inf...
3O52_A        79 QL-------IESCAGLLDN-DEPEVCIRKEAIEETGYEV--GEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGGV 148 Escherichia col...
1G0S_A       161 DENEDIRVHVVSReQAYQWVEEGKIDNAASVIALQWLQL 199 Escherichia coli K-12
P37128       149 EDEDIEVLELPFS-QALEMIKTGEIRDGKTVLLLNYLQT 186 Escherichia coli K-12
P36651       161 DENEDIRVHVVSReQAYQWVEEGKIDNAASVIALQWLQL 199 Escherichia coli
WP_000119978 169 DTERIEVLFLERS-KALDFIMDFQYAKTTGLSLAILWHL 206 Helicobacter pylori
P44684       167 EENEDIKVHVVKReQAYQWMCEGKIDNGIAVIGLQWLQL 205 Haemophilus influenzae Rd KW20
3O52_A       149 EDEDIEVLELPFS-QALEMIKTGEIRDGKTVLLLNYLQT 186 Escherichia coli ATCC 8739
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap