
Conserved Protein Domain Family

TIGR00052: TIGR00052 
Click on image for an interactive view with Cn3D
nudix-type nucleoside diphosphatase, YffH/AdpP family
Members of this family include proteins of about 200 amino acids, including the recently characterized nudix hydrolase YffH, shows to be highly active as a GDP-mannose pyrophosphatase. It also includes the C-terminal half of a 361-amino acid protein, TrgB from Rhodobacter sphaeroides, shown experimentally to help confer tellurite resistance. This model also hits a region near the C-terminus of a 1092-amino acid protein of C. elegans. [Unknown function, Enzymes of unknown specificity]
PSSM-Id: 129162
Aligned: 6 rows
Threshold Bit Score: 268.613
Threshold Setting Gi: 446042123
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P37128       149 EDEDIEVLELPFS-QALEMIKTGEIRDGKTVLLLNYLQT 186 Escherichia coli K-12
P44684       167 EENEDIKVHVVKReQAYQWMCEGKIDNGIAVIGLQWLQL 205 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap