1S5U,2EGI,2PZH,1NJK


Conserved Protein Domain Family
TIGR00051

?
TIGR00051: TIGR00051 
Click on image for an interactive view with Cn3D
acyl-CoA thioester hydrolase, YbgC/YbaW family
This model describes a subset of related acyl-CoA thioesterases that include several at least partially characterized proteins. YbgC is an acyl-CoA thioesterase associated with the Tol-Pal system. YbaW is part of the FadM regulon. [Unknown function, General]
Statistics
?
PSSM-Id: 129161
View PSSM: TIGR00051
Aligned: 11 rows
Threshold Bit Score: 152.188
Threshold Setting Gi: 6176568
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S5U_A        11 PVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHH--FSQQALMA-ERVAFVVRKMTVEYYAPARLDDMLEIQTEITSM 87  Escherichia coli
P44679         9 PVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLN--FTQQTLLEeQQLAFVVKTLAIDYCVAAKLDDLLMVETEVSEV 86  Haemophilus inf...
P08999         9 PVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHH--FSQQALMA-ERVAFVVRKMTVEYYAPARLDDMLEIQTEITSM 85  Escherichia coli
P94842         2 RCRVYYEDTDSEGVVYHANYLKYCERARSEFF------FKQNVLPEnEEGVFVIRSIKADFFTPASLGQVLEIRTQIKEL 75  Helicobacter py...
P77712         6 KVR-GYH-LDVYQHVNNARYLEFLEEARWDGLENSDs-F-QWMTAh-N-IAFVVVNININYRRPAVLSDLLTITSQLQQL 79  Escherichia col...
O67466         6 RRRVQFYETDAQGIVHHSNYFRYFEEARGEFLRSKG--FPYSKMRD-MGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEEL 82  Aquifex aeolicu...
WP_003231566  17 qM----------GIVYHANYLVWMEVGRTALIKDLG--FLYSDMEK-KGVLSPVVDINISYKKPLHYGETAVVHTWIEDY 83  Bacillus subtilis
AAC41422      11 PLRVRWAEVDPQSIVFNAHYLTYCDICVTEYWRALGirYPEDVLHA-HGVDIFVVKSTLEYHASARFDDELEIRGRMSRL 89  Cupriavidus nec...
2EGI_A         6 RRRVQFYETDAQGIVHHSNYFRYFEEARGEFLRSKG--FPYSKMRD-MGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEEL 82  Aquifex aeolicu...
2PZH_A         4 RCRVYYEDTDSEGVVYHANYLKYCERARSEFF------FKQNVLPEnEEGVFVIRSIKADFFTPASLGQVLEIRTQIKEL 77  Helicobacter py...
1NJK_A        26 qIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSD--SFQWXTAH-N-IAFVVVNININYRRPAVLSDLLTITSQLQQL 101 Escherichia coli
1S5U_A        88 RGTSLVFTQRIVNAENTLLNEAEVLVv-CVDPLKMKPRALP 127 Escherichia coli
P44679        87 KGATILFEQRLMRNTLMLSKATVKVA--CVDLGKMKPVAFP 125 Haemophilus influenzae Rd KW20
P08999        86 RGTSLVFTQRIVNAENTLLNEAEVLVv-CVDPLKMKPRALP 125 Escherichia coli
P94842        76 RKVFVVLFQEIYCIQNASLEPMKPFKv-FASEIKFGFVNRS 115 Helicobacter pylori 26695
P77712        80 NGKSGILSQVITLEPEGQVVADALITfvCIDLKTQKALALE 120 Escherichia coli K-12
O67466        83 SRFTFTFSYIVFKEDIAVAKANTK-H--CMV-KNGKIVSIP 119 Aquifex aeolicus VF5
WP_003231566  84 NGFKTVYGYHIYNPAGELSIKATSSHi-CVDKESFKPIQFR 123 Bacillus subtilis
AAC41422      90 GRSSMLFRVEMFRGDEHLITGEIVYV--CADPATQKSAAIP 128 Cupriavidus necator
2EGI_A        83 SRFTFTFSYIVFKEDIAVAKANTKh---CMV-KNGKIVSIP 119 Aquifex aeolicus VF5
2PZH_A        78 RKVFVVLFQEIYCIQNASLEPMKPFKv-FASEIKFGFVNRS 117 Helicobacter pylori 26695
1NJK_A       102 NGKSGILSQVITLEPEGQVVADALITfvCIDLKTQKALALE 142 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap