Conserved Protein Domain Family

TIGR00051: TIGR00051 
Click on image for an interactive view with Cn3D
acyl-CoA thioester hydrolase, YbgC/YbaW family
This model describes a subset of related acyl-CoA thioesterases that include several at least partially characterized proteins. YbgC is an acyl-CoA thioesterase associated with the Tol-Pal system. YbaW is part of the FadM regulon. [Unknown function, General]
PSSM-Id: 129161
Aligned: 11 rows
Threshold Bit Score: 152.188
Threshold Setting Gi: 6176568
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P44679        87 KGATILFEQRLMRNTLMLSKATVKVA--CVDLGKMKPVAFP 125 Haemophilus influenzae Rd KW20
P94842        76 RKVFVVLFQEIYCIQNASLEPMKPFKv-FASEIKFGFVNRS 115 Helicobacter pylori 26695
P77712        80 NGKSGILSQVITLEPEGQVVADALITfvCIDLKTQKALALE 120 Escherichia coli K-12
O67466        83 SRFTFTFSYIVFKEDIAVAKANTK-H--CMV-KNGKIVSIP 119 Aquifex aeolicus VF5
2PZH_A        78 RKVFVVLFQEIYCIQNASLEPMKPFKv-FASEIKFGFVNRS 117 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap