1QR7,1HFB


Conserved Protein Domain Family
aroFGH

?
TIGR00034: aroFGH 
Click on image for an interactive view with Cn3D
phospho-2-dehydro-3-deoxyheptonate aldolase
[Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 129145
View PSSM: TIGR00034
Aligned: 9 rows
Threshold Bit Score: 614.429
Threshold Setting Gi: 144965
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QR7_A         6 DDLRIKEI-KE--LLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREE 82  Escherichia coli
WP_001168037   4 DALNNVHItDEqvLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALAAE 83  Enterobacteriaceae
WP_010869242  13 DDTRIEKV-DQ--VLPPIALLEKYPASEQAAALVKQTRHEAHNIIHGKDDRLLVVIGPCSIHDPKAAIEYATRLKPLREK 89  Haemophilus inf...
AAA23497       5 DELRTARI-ES--LVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAMEYATRLQSLRNQ 81  Escherichia coli
AAC43604       5 DELRTIRI-DP--LITPSELAKKYAITSEIMDNVIITRQNIARIMTGEDLRLLVVIGPCSVHDPIAAVEYAHRLYELRKK 81  Buchnera aphidi...
NP_010320     15 EDWRIKGY-DP--LTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHDPKAAYDYADRLAKISEK 91  Saccharomyces c...
1HFB_A        21 EDVRILGY-DP--LASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHDLEAAQEYALRLKKLSDE 97  baker's yeast
AAA27030       4 DALNNVRItDEqvLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALAAE 83  Salmonella ente...
AAA23292      14 SNKRVVAF-HE--LPSPTDLIAANPLTPKQASKVEQDRQDIADIFAGDDDRLVVVVGPCSVHDPEAAIDYANRLAPLAKR 90  Corynebacterium...
1QR7_A        83 LKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAI 162 Escherichia coli
WP_001168037  84 VSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAI 163 Enterobacteriaceae
WP_010869242  90 YKDSLEIIMRVYFEKPRTTVGWKGLINEPYLNDTYRLNDGLRIARKLLSDINDLGVPAAGEFLDMITPQYLADFMSWGAI 169 Haemophilus inf...
AAA23497      82 YQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAI 161 Escherichia coli
AAC43604      82 YQDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINELGCLQQQSFLDMVIGQFIADLISWGAI 161 Buchnera aphidi...
NP_010320     92 LSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRISREMFIKLVEK-LPIAGEMLDTISPQFLSDCFSLGAI 170 Saccharomyces c...
1HFB_A        98 LKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQSARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAI 177 baker's yeast
AAA27030      84 VSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPLATEALDPNSPQYLGDLFSWSAI 163 Salmonella ente...
AAA23292      91 LDQDLKIVMRVYFEKPRTTVGWKGLINDPHLNETYDIPEGLRIARKVLIDVVNLDLPVGCEFLEPNSPQYYADTVAWGAI 170 Corynebacterium...
1QR7_A       163 GARTTESQVH-RELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKE-PN 240 Escherichia coli
WP_001168037 164 GARTTESQTH-REMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKA-PN 241 Enterobacteriaceae
WP_010869242 170 GARTTESQVH-RELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHYFLSVTKFGHSAIVSTKGNEDCHIILRGGDKgPN 248 Haemophilus inf...
AAA23497     162 GARTTESQIH-REMASALSCPVGFKNGTDGNTRIAVDAIRAARASHMFLSPDKNGQMTIYQTSGNPYGHIIMRGGKK-PN 239 Escherichia coli
AAC43604     162 GARTTESQIH-REMASALSCPVGFKNGTDGNIRIAIDAIRAAQARHLFFAPNKDGQMTINHTSGNPYGHIIMRGGRT-PN 239 Buchnera aphidi...
NP_010320    171 GARTTESQLH-RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNgTN 249 Saccharomyces c...
1HFB_A       178 GARTTESQLH-RELASGLSFPVGFKNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKgTN 256 baker's yeast
AAA27030     164 GARTTESQTH-REMASGLSMPVAFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPHGHVILRGGKA-PN 241 Salmonella ente...
AAA23292     171 GARTTESQVHrRQLASGMSMPIGFKNGTDGNIQVAVDAVQAAQNPHFFFGTSDDGALSVVETAGNSNSHIILRGGTSgPN 250 Corynebacterium...
1QR7_A       241 YSAKHVAEVKEGLNKAGLPA----QVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHLVEGNQSLe--- 313 Escherichia coli
WP_001168037 242 YSPADVAQCEKEMEQAGLRP----SLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS---- 313 Enterobacteriaceae
WP_010869242 249 YSAEDVEKVCADIEKTGRIP----HVMVDFSHANSSKQYKKQMDVCQDVCNQIAFGSKQIFGVMVESHLVEGRQDLv--- 321 Haemophilus inf...
AAA23497     240 YHADDIAAACDTLHEFDLPE----HLVVDFSHGNCQKQHRRQLEVCEDICQQIRNGSTAIAGIMAESFLREGTQKIv--- 312 Escherichia coli
AAC43604     240 YHAHDINSAIEHLREFNLLE----HLMIDFSHGNCLKEHIRQKDVAKSVSKQISQGSKTIFGVMIESFLEEGFQTVk--- 312 Buchnera aphidi...
NP_010320    250 FDKESVQNTKKQLEKAGLTDdsqkRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVMIESNINEGRQDIpke- 328 Saccharomyces c...
1HFB_A       257 YDAKSVAEAKAQLPAGSNG------LMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITGVMIESNINEGNQGIpa-- 328 baker's yeast
AAA27030     242 YSPADVAQCEKEMEQAGLRP----SLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS---- 313 Salmonella ente...
AAA23292     251 HDAASVEAV---VEKLGENA----RLMIDASHANSGKDHIRQVEVVREIAEQISGGSEAVAGIMIESFLVGGAQNLdpak 323 Corynebacterium...
1QR7_A       314 ----sGEP---LAYGKSITDACIGWEDTDALLRQLANAVKARR 349 Escherichia coli
WP_001168037 314 -----EQPrseMKYGVSVTDACISWEMTDALLREIHQDLNGQL 351 Enterobacteriaceae
WP_010869242 322 ----dGKA---QTYGQSITDACIGWEDSERLLQQLSDAVIARR 357 Haemophilus influenzae
AAA23497     313 ----gSQP---LTYGQSITDPCLGWEDSERLVEKLASAVDTRF 348 Escherichia coli
AAC43604     313 ----eNQP---LIYGKSITDACLNWKDSVLIIKQLADAVDTRF 348 Buchnera aphidicola
NP_010320    329 ---ggREG---LKYGCSVTDACIGWESTEQVLELLAEGVRNRR 365 Saccharomyces cerevisiae S288c
1HFB_A       329 ---egKAG---LKYGVSITDACIGWETTEDVLRKLAAAVRQRR 365 baker's yeast
AAA27030     314 -----EQPrseMKYGVSVTDACISWEMTDALLREIHKDLSGQL 351 Salmonella enterica subsp. enterica serovar Typhimurium
AAA23292     324 lringGEG---LVYGQSVTDKCIDIDTTIDLLAELATAVRERR 363 Corynebacterium glutamicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap