1K97


Conserved Protein Domain Family
argG

?
TIGR00032: argG 
Click on image for an interactive view with Cn3D
argininosuccinate synthase
argG in bacteria, ARG1 in Saccharomyces cerevisiae. There is a very unusual clustering in the alignment, with a deep split between one cohort of E. coli, H. influenzae, and Streptomyces, and the other cohort of eukaryotes, archaea, and the rest of the eubacteria. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 199987
Aligned: 9 rows
Threshold Bit Score: 603.245
Threshold Setting Gi: 2492988
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K97_A        12 RIGIAFSGGLDTSAALLWMRQK-GA-VPYAYTANLGQpdEEDYDAIPRRAMEYGAENARLIDCRKQLVAE-GIAAIQCGA 88  Escherichia coli
P22768         5 KVCLAYSGGLDTSVILAWLLDQ-GY-EVVAFMANVGQ--EEDFDAAKEKALKIGACKFVCVDCREDFVKDiLFPAVQVNA 80  Saccharomyces c...
P77973         6 KVVLAYSGGVDTSVCIPYLMHEwGVeEVITLAADLGQg--DELGPIQEKALRCGAVESLVIDGKEEFVKEyAFRSIQANA 83  Synechocystis s...
O34347         6 KVVLAYSGGLDTSVAIKWLQEQ-GY-NVIACCLDVGEg--KDLAFVQQKALEVGATNSYVIDAKEEFAQDyALISLQAHT 81  Bacillus subtil...
Q60174         4 IAVLAYSGGLDTSCCLKLLEDKyGY-KVVSVCVDVGQp-EEEIKEVEEKAKKLGVLKHYTIDAKEEFVKDyIFRAIKANA 81  Methanocaldococ...
O27322         8 KVVLAFSGGLDTSVCIKLLEEKyNM-EVITACVDVGQp-RDEIERPAMVAKELGNYRHYTVDARREFAEDyIFPAIKANA 85  Methanothermoba...
O28032         2 KVVLSYSGGLDTTVCIPLLKEKyGFdEVITVTVDIGQp-EADIKQAEERGKKY-ADKHYTIDAKKEFVDS-LFMLIKANG 78  Archaeoglobus f...
WP_001483159  13 RIGIAFSGGLDTSAALLWMRQK-GA-VPYAYTANLGQpdEEDYDAIPRRAMEYGAENARLIDCRKQLVAE-GIAAIQCGA 89  Escherichia coli
P44315        14 KVGIAFSGGLDTSAALLWMRQK-GA-VPYAYTANLGQpdEDDYNAIPKKAMAYGAENARLIDCRAQLAHE-GIAAIQCGA 90  Haemophilus inf...
P22768         5 KVCLAYSGGLDTSVILAWLLDQ-GY-EVVAFMANVGQ--EEDFDAAKEKALKIGACKFVCVDCREDFVKDiLFPAVQVNA 80  Saccharomyces c...
P77973         6 KVVLAYSGGVDTSVCIPYLMHEwGVeEVITLAADLGQg--DELGPIQEKALRCGAVESLVIDGKEEFVKEyAFRSIQANA 83  Synechocystis s...
O34347         6 KVVLAYSGGLDTSVAIKWLQEQ-GY-NVIACCLDVGEg--KDLAFVQQKALEVGATNSYVIDAKEEFAQDyALISLQAHT 81  Bacillus subtil...
Q60174         4 IAVLAYSGGLDTSCCLKLLEDKyGY-KVVSVCVDVGQp-EEEIKEVEEKAKKLGVLKHYTIDAKEEFVKDyIFRAIKANA 81  Methanocaldococ...
O27322         8 KVVLAFSGGLDTSVCIKLLEEKyNM-EVITACVDVGQp-RDEIERPAMVAKELGNYRHYTVDARREFAEDyIFPAIKANA 85  Methanothermoba...
O28032         2 KVVLSYSGGLDTTVCIPLLKEKyGFdEVITVTVDIGQp-EADIKQAEERGKKY-ADKHYTIDAKKEFVDS-LFMLIKANG 78  Archaeoglobus f...
WP_001483159  13 RIGIAFSGGLDTSAALLWMRQK-GA-VPYAYTANLGQpdEEDYDAIPRRAMEYGAENARLIDCRKQLVAE-GIAAIQCGA 89  Escherichia coli
P44315        14 KVGIAFSGGLDTSAALLWMRQK-GA-VPYAYTANLGQpdEDDYNAIPKKAMAYGAENARLIDCRAQLAHE-GIAAIQCGA 90  Haemophilus inf...
1K97_A        89 FHNTtggltYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIdelggR 168 Escherichia coli
P22768        81 VYEDv----YLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVKCITPWRMPEFFerfagR 156 Saccharomyces c...
P77973        84 LYENr----YPLSTALARPLIAKMLVEAAEKYGADAVAHGCTGKGNDQVRFDISIMALNPNLKVLAPAREWKMS-----R 154 Synechocystis s...
O34347        82 MYEGk----YPLVSALSRPLIAKKLVEIAEKEDAQAIAHGCTGKGNDQVRFEVSIKSLNPDLEVIAPVREWQWS-----R 152 Bacillus subtil...
Q60174        82 MYEG-----YPLSTALARPLIAHKVVEIAEEVGAEAVAHGCTGKGNDQFRFETTIRIKAPHLKIIAPIRDLNLT-----R 151 Methanocaldococ...
O27322        86 VYEG-----YPLSTALARPLIAKKIVEVAEKEGASAIAHGCTGKGNDQFRFEAVIR-STTDLDVIAPIRDLNLT-----R 154 Methanothermoba...
O28032        79 NYEG-----YVLGTALARPLIAEKVVEVAKKEGAEAVAHGCTGKGNDQLRFENIFR--QHGFKVIAPVRELNLT-----R 146 Archaeoglobus f...
WP_001483159  90 FHNTtggltYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIdelggR 169 Escherichia coli
P44315        91 FHIStggipYFNTTPLGRAVTGTMLVAAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPNLKIYKPWLDVQFIeelggR 170 Haemophilus inf...
P22768        81 VYEDv----YLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVKCITPWRMPEFFerfagR 156 Saccharomyces c...
P77973        84 LYENr----YPLSTALARPLIAKMLVEAAEKYGADAVAHGCTGKGNDQVRFDISIMALNPNLKVLAPAREWKMS-----R 154 Synechocystis s...
O34347        82 MYEGk----YPLVSALSRPLIAKKLVEIAEKEDAQAIAHGCTGKGNDQVRFEVSIKSLNPDLEVIAPVREWQWS-----R 152 Bacillus subtil...
Q60174        82 MYEG-----YPLSTALARPLIAHKVVEIAEEVGAEAVAHGCTGKGNDQFRFETTIRIKAPHLKIIAPIRDLNLT-----R 151 Methanocaldococ...
O27322        86 VYEG-----YPLSTALARPLIAKKIVEVAEKEGASAIAHGCTGKGNDQFRFEAVIR-STTDLDVIAPIRDLNLT-----R 154 Methanothermoba...
O28032        79 NYEG-----YVLGTALARPLIAEKVVEVAKKEGAEAVAHGCTGKGNDQLRFENIFR--QHGFKVIAPVRELNLT-----R 146 Archaeoglobus f...
WP_001483159  90 FHNTtggltYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIdelggR 169 Escherichia coli
P44315        91 FHIStggipYFNTTPLGRAVTGTMLVAAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPNLKIYKPWLDVQFIeelggR 170 Haemophilus inf...
1K97_A       169 HEMSEFMIACGFDYKMSVEKAYSTDSNMLGATHEAKDLEYLnSSVKIVNPIMGVKFWDESVkIPAEEVTVRFEQGHPVAL 248 Escherichia coli
P22768       157 KDLLDYAAQKGIPVAQTKAKPWSTDENQAHISYEAGILEDP-DTTPPKDMWKLIVDPMDAP-DQPQDLTIDFERGLPVKL 234 Saccharomyces c...
P77973       155 EETIAYGERYGVESPVKKSSPYSIDRNILGRSIEAGPLEDP-MTEPTEEIYLMTK-AIADTpDEPEYVDIGFEKGIPVSL 232 Synechocystis s...
O34347       153 EEEIEYAASRGIPIPINLDSPYSIDQNLWGRANECGILEDP-WAAPPEGAYDLTA-PLEKTpDTPEVIEIAFEQGVPVSI 230 Bacillus subtil...
Q60174       152 AEEIEYAKEKGIPIPTES-KKYSIDENLWGRSIEGSELENP-DFVPPEEIYAWTKNPVEDK-EE-EIVEIEFKEGVPVAI 227 Methanocaldococ...
O27322       155 TEEMEYARSCGIPLPSD--KLYSIDENLWGRAIEGDILEDP-MVEPPEDAFEWTK-PIHETpEDPEVIEIGFHGGVPVAL 230 Methanothermoba...
O28032       147 EWEIEYARQHGIEVPATKEKPYSIDENLWSRSVEGGKLEDP-SFEPPEDIYEWTASPEKAP-DKPEIVKIDFEKGVPVAL 224 Archaeoglobus f...
WP_001483159 170 HEMSEFMIACGFDYKMSVEKAYSTDSNMLGATHEAKDLEYLnSSVKIVNPIMGVKFWDESVkIPAEEVTVRFEQGHPVAL 249 Escherichia coli
P44315       171 LEMSQFLIENGFDYKMSVEKAYSTDSNMLGATHEAKDLEQLsTGMKIVKPIMGVAFWDEKVeIKPETVTVTFEDGVPVAL 250 Haemophilus inf...
P22768       157 KDLLDYAAQKGIPVAQTKAKPWSTDENQAHISYEAGILEDP-DTTPPKDMWKLIVDPMDAP-DQPQDLTIDFERGLPVKL 234 Saccharomyces c...
P77973       155 EETIAYGERYGVESPVKKSSPYSIDRNILGRSIEAGPLEDP-MTEPTEEIYLMTK-AIADTpDEPEYVDIGFEKGIPVSL 232 Synechocystis s...
O34347       153 EEEIEYAASRGIPIPINLDSPYSIDQNLWGRANECGILEDP-WAAPPEGAYDLTA-PLEKTpDTPEVIEIAFEQGVPVSI 230 Bacillus subtil...
Q60174       152 AEEIEYAKEKGIPIPTES-KKYSIDENLWGRSIEGSELENP-DFVPPEEIYAWTKNPVEDK-EE-EIVEIEFKEGVPVAI 227 Methanocaldococ...
O27322       155 TEEMEYARSCGIPLPSD--KLYSIDENLWGRAIEGDILEDP-MVEPPEDAFEWTK-PIHETpEDPEVIEIGFHGGVPVAL 230 Methanothermoba...
O28032       147 EWEIEYARQHGIEVPATKEKPYSIDENLWSRSVEGGKLEDP-SFEPPEDIYEWTASPEKAP-DKPEIVKIDFEKGVPVAL 224 Archaeoglobus f...
WP_001483159 170 HEMSEFMIACGFDYKMSVEKAYSTDSNMLGATHEAKDLEYLnSSVKIVNPIMGVKFWDESVkIPAEEVTVRFEQGHPVAL 249 Escherichia coli
P44315       171 LEMSQFLIENGFDYKMSVEKAYSTDSNMLGATHEAKDLEQLsTGMKIVKPIMGVAFWDEKVeIKPETVTVTFEDGVPVAL 250 Haemophilus inf...
1K97_A       249 N--------GKTFsD-DVEMMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQY 319 Escherichia coli
P22768       235 TytdnktskEVSV-TkPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDLEGLTLDKEVRQLR 313 Saccharomyces c...
P77973       233 N--------GVML-D-PVTLVERLNEIAGNHGVGRLDMVENRVVGIKSREIYEAPALLVLIDAHRDLESLTQTADVTHYK 302 Synechocystis s...
O34347       231 D--------GVSY-S-LSELILKLNEMAGAHGVGRIDHVENRLVGIKSREVYECPGAMTLIKAHKELEDLTLVKEVAHFK 300 Bacillus subtil...
Q60174       228 N--------GEKL-E-PVELIKKANEIAGKHGVGRIDIIEDRIIGLKSRENYECPGAVLLLTAHKALEQLVLTRDELRFK 297 Methanocaldococ...
O27322       231 N--------GEEL-E-PVELIGLANEVAGKHGIGRVDIMEDRIIGMKSREIYETPAAFLLLEAHRGLEQLTLTRSELRFA 300 Methanothermoba...
O28032       225 N--------DERM-G-GFELIKALNEIGGKHGVGRTDMIEDRVLGLKARENYEHPAATILITAHRDLENLVLSRRELKFK 294 Archaeoglobus f...
WP_001483159 250 N--------GKTF-SdDVEMMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQY 320 Escherichia coli
P44315       251 N--------GKHF-DnAVDLILEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQY 321 Haemophilus inf...
P22768       235 TytdnktskEVSV-TkPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDLEGLTLDKEVRQLR 313 Saccharomyces c...
P77973       233 N--------GVML-D-PVTLVERLNEIAGNHGVGRLDMVENRVVGIKSREIYEAPALLVLIDAHRDLESLTQTADVTHYK 302 Synechocystis s...
O34347       231 D--------GVSY-S-LSELILKLNEMAGAHGVGRIDHVENRLVGIKSREVYECPGAMTLIKAHKELEDLTLVKEVAHFK 300 Bacillus subtil...
Q60174       228 N--------GEKL-E-PVELIKKANEIAGKHGVGRIDIIEDRIIGLKSRENYECPGAVLLLTAHKALEQLVLTRDELRFK 297 Methanocaldococ...
O27322       231 N--------GEEL-E-PVELIGLANEVAGKHGIGRVDIMEDRIIGMKSREIYETPAAFLLLEAHRGLEQLTLTRSELRFA 300 Methanothermoba...
O28032       225 N--------DERM-G-GFELIKALNEIGGKHGVGRTDMIEDRVLGLKARENYEHPAATILITAHRDLENLVLSRRELKFK 294 Archaeoglobus f...
WP_001483159 250 N--------GKTF-SdDVEMMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQY 320 Escherichia coli
P44315       251 N--------GKHF-DnAVDLILEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQY 321 Haemophilus inf...
1K97_A       320 H-AHGRQLGRLLYQGRWFDSQALMLrDSLQRWVASQITGEVTLELRRGNDYSILNTvSENLTYKPERLTMEk-gDSVFSP 397 Escherichia coli
P22768       314 DsFVTPNYSRLIYNGSYFTPECEYI-RSMIQPSQNSVNGTVRVRLYKGNVIILGRStKTEKLYDPTESSMDe--LTGFLP 390 Saccharomyces c...
P77973       303 N-TVEEIYSQLIYRGLWYSPLKEAL-DAFIVKTQERVTGMVRVKFFKGNANVAGRK-SDYSIYDAELATYGm--EDQFDH 377 Synechocystis s...
O34347       301 P-IIEQKMSEIIYNGLWFSPLKDAL-HAFLKETQKHVTGIVRVKLFKGHAIVEGRK-SEYSLYDEKLATYTk--DDAFDH 375 Bacillus subtil...
Q60174       298 E-IVDSLYGELIYKGLWFDPLREDL-DAFIDKTQERVTGTVKVKLFGGTARVVGRD-SPYALYSKELVSFD---EKEIDQ 371 Methanocaldococ...
O27322       301 D-IISSTYAELVYSGLWHDPLREDL-DMAVNHMQRRVTGTVRVKLHRGSMRVIGRE-SPYSLYSEEIVSFE---DKTLDQ 374 Methanothermoba...
O28032       295 K-FVEEEWAELVYYGLVNDPLFDAL-NAFIDKTQERVTGWVKVKLYKGSAVVVARN-SPYALYSEELVSFD---TESIDQ 368 Archaeoglobus f...
WP_001483159 321 H-AHGRQLGRLLYQGRWFDSQALMLrDSLQRWVASQITGEVTLELRRGNDYSILNTvSENLTYKPERLTMEk-gDSVFSP 398 Escherichia coli
P44315       322 R-INGIRLGRLLYQGRWFDPQALMLrETAQRWVAKAITGTVTLELRRGNDFTILNTeSPNLTYEAERLSMEkveDAPFDP 400 Haemophilus inf...
P22768       314 DsFVTPNYSRLIYNGSYFTPECEYI-RSMIQPSQNSVNGTVRVRLYKGNVIILGRStKTEKLYDPTESSMDe--LTGFLP 390 Saccharomyces c...
P77973       303 N-TVEEIYSQLIYRGLWYSPLKEAL-DAFIVKTQERVTGMVRVKFFKGNANVAGRK-SDYSIYDAELATYGm--EDQFDH 377 Synechocystis s...
O34347       301 P-IIEQKMSEIIYNGLWFSPLKDAL-HAFLKETQKHVTGIVRVKLFKGHAIVEGRK-SEYSLYDEKLATYTk--DDAFDH 375 Bacillus subtil...
Q60174       298 E-IVDSLYGELIYKGLWFDPLREDL-DAFIDKTQERVTGTVKVKLFGGTARVVGRD-SPYALYSKELVSFD---EKEIDQ 371 Methanocaldococ...
O27322       301 D-IISSTYAELVYSGLWHDPLREDL-DMAVNHMQRRVTGTVRVKLHRGSMRVIGRE-SPYSLYSEEIVSFE---DKTLDQ 374 Methanothermoba...
O28032       295 K-FVEEEWAELVYYGLVNDPLFDAL-NAFIDKTQERVTGWVKVKLYKGSAVVVARN-SPYALYSEELVSFD---TESIDQ 368 Archaeoglobus f...
WP_001483159 321 H-AHGRQLGRLLYQGRWFDSQALMLrDSLQRWVASQITGEVTLELRRGNDYSILNTvSENLTYKPERLTMEk-gDSVFSP 398 Escherichia coli
P44315       322 R-INGIRLGRLLYQGRWFDPQALMLrETAQRWVAKAITGTVTLELRRGNDFTILNTeSPNLTYEAERLSMEkveDAPFDP 400 Haemophilus inf...
1K97_A       398 DDRIGQLTMRNLDITDTREKLF 419 Escherichia coli
P22768       391 TDTTGFIAIQAIRIKKYGESKK 412 Saccharomyces cerevisiae S288c
P77973       378 KAAEGFIYIWGLPTKVWAQKMR 399 Synechocystis sp. PCC 6803 substr. Kazusa
O34347       376 HAAIGFIELWGLPTKVNSIVKK 397 Bacillus subtilis subsp. subtilis str. 168
Q60174       372 KELAGMVKYHGLQAMLYEMRKK 393 Methanocaldococcus jannaschii DSM 2661
O27322       375 REMAGMVKNYALQAAIYSRVCR 396 Methanothermobacter thermautotrophicus str. Delta H
O28032       369 RLAEGFAAFHGLQGRLFRRLFQ 390 Archaeoglobus fulgidus DSM 4304
WP_001483159 399 DDRIGQLTMRNLDITDTREKLF 420 Escherichia coli
P44315       401 IDRIGQLTMRNLDVSDTRGKLG 422 Haemophilus influenzae Rd KW20
P22768       391 TDTTGFIAIQAIRIKKYGESKK 412 Saccharomyces cerevisiae S288c
P77973       378 KAAEGFIYIWGLPTKVWAQKMR 399 Synechocystis sp. PCC 6803 substr. Kazusa
O34347       376 HAAIGFIELWGLPTKVNSIVKK 397 Bacillus subtilis subsp. subtilis str. 168
Q60174       372 KELAGMVKYHGLQAMLYEMRKK 393 Methanocaldococcus jannaschii DSM 2661
O27322       375 REMAGMVKNYALQAAIYSRVCR 396 Methanothermobacter thermautotrophicus str. Delta H
O28032       369 RLAEGFAAFHGLQGRLFRRLFQ 390 Archaeoglobus fulgidus DSM 4304
WP_001483159 399 DDRIGQLTMRNLDITDTREKLF 420 Escherichia coli
P44315       401 IDRIGQLTMRNLDVSDTRGKLG 422 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap