Conserved Protein Domain Family
SbcD_rel_arch

?
TIGR00024: SbcD_rel_arch 
putative phosphoesterase, SbcD/Mre11-related
Members of this uncharacterized family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11. SbcD is a subunit of the SbcCD nuclease of E. coli that can cleave DNA hairpins to unblock stalled DNA replication. All members of this family are archaeal. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129135
View PSSM: TIGR00024
Aligned: 4 rows
Threshold Bit Score: 253.24
Threshold Setting Gi: 499181149
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q60344         7 IKDFYITVDRCLVYKDYAIIADTHIGFDVFFGEGGANFPLLQKDEVIKRTLNIIDKYKINNLIINGDIKHNFKPy-pKEI 85  Methanocaldococ...
WP_010877405   6 LMDDLEICDLSLIIEDSMVIADLHLGYEQYLNTQGVMVPGFQFRRIIERIDAIRDVSGASGIIINGDLKHEFGR---VSW 82  Methanothermoba...
WP_010878652   1 MEDVLLTPERAAIVGNTAVIADLHLGFENVLQERGYAVPRMQVEEIKARVASIVEKYGIAKIVVAGDLKHEFSKnlpYEW 80  Archaeoglobus f...
WP_010878689   1 ----MRIEEDVLFIGRKAVIADIHLGLVRHYDN-----------ELIEKALSIAER--VEALIVAGDLKHIGKKg--LHE 61  Archaeoglobus f...
Q60344        86 KFLKE------FIEFLREyiNVILIKGNHDTFISS----AGYEIFDYFELGNYLIFHGDKeiKIdrDLLKEKFWILGHEH 155 Methanocaldococ...
WP_010877405  83 QENREiirmmqYLEENFR--DITIIRGNHDALIPYmsqvSHLSVTETLKISCFLLAHGHV--VP--EDLDAETIIIGHEH 156 Methanothermoba...
WP_010878652  81 EDVRE------FIESVNV--ELEVVRGNHDNYLAAilaeYGIELKESVRVGDYLVVHGH-------KDCEEEKVIMGHEH 145 Archaeoglobus f...
WP_010878689  62 RFIRE------IGEVT----DLILIRGNHD---------IGLSGEKSIRIGKYGIFHGHA--VPdeEVLDAKVLIFGHAH 120 Archaeoglobus f...
Q60344       156 PSIKLRDDVgAILKFPTYLLN----KNYIVLPAFNPLSPGNDLINNSASSKIIKKS-YLEAEVIAITDIGLLNFGTLRDL 230 Methanocaldococ...
WP_010877405 157 PCVGLRSGE-RVEKIKCFLLGpfrdMKLLVMPSFNFVTEGSDILHEDILSPFLRESeLTEFLVYGVEDFEIFEFGTVGDL 235 Methanothermoba...
WP_010878652 146 PAVKVRVRG-ALYTFPCYLVAd---GAKIVLPAFSPLMSGSDVLQGNFLSPILQKA--RKIEVYAIEE-EVVYLGSIEDL 218 Archaeoglobus f...
WP_010878689 121 PAYFVKDSA-GGYRERVFLTGevedKRVVVLPAFNDLCASTAVNLDRPAGFMFR----R--YDYKRWY-AIMLDGTLLRI 192 Archaeoglobus f...
Q60344       231 REF 233 Methanocaldococcus jannaschii DSM 2661
WP_010877405 236 LKF 238 Methanothermobacter thermautotrophicus
WP_010878652 219 RKI 221 Archaeoglobus fulgidus
WP_010878689 193 F-- 193 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap