1JOP


Conserved Protein Domain Family
TIGR00022

?
TIGR00022: TIGR00022 
Click on image for an interactive view with Cn3D
YhcH/YjgK/YiaL family protein
This family consists of conserved hypothetical proteins, about 150 amino acids in length. Members with limited information include YhcH, a possible sugar isomerase of sialic acid catabolism, and YjgK. [Unknown function, General]
Statistics
?
PSSM-Id: 129133
View PSSM: TIGR00022
Aligned: 6 rows
Threshold Bit Score: 205.774
Threshold Setting Gi: 446509952
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JOP_A         1 MIISSLTNPNFKvGLPKVIAEVCDYLNTLDLNALENGRHDIN-DQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTE 79  Haemophilus inf...
P45424         1 MMMGEVQSLPSA-GLHPALQDALTLALAARPQEKAPGRYELQgDNIFMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEE 79  Escherichia col...
P37673         1 MIFGHIAQPNPCr-LPAAIEKALDFLRATDFNALEPGVVEIDgKNIYTQIIDLTTREAVVNRPEVHRRYIDIQFLAWGEE 79  Escherichia col...
P44583         1 MIISSLTNPNFKvGLPKVIAEVCDYLNTLDLNALENGRHDIN-DQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTE 79  Haemophilus inf...
WP_000587470   1 MIITKISRLGTYvGVNPHFATLIDFLEKTGLENLTEGSIAIDgNRLFGNCFTYLADGQAGAFFETHQKYLDIHLVLENEE 80  Streptococcus p...
WP_000413882   4 MIIGNIHNLQPW--LPQELRQAIEHIKAHVTAETPKGKHDIEgNRLFYLISEDMTEPYEARRAEYHARYLDIQIVLKGQE 81  Enterobacteriaceae
1JOP_A        80 NIEVGATYPNLSKyEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVVNG-KTE 141 Haemophilus influenzae
P45424        80 RILFGMAGTARQC-EEFHHEDDYQLCSTIDNEQAIILKPGMFAVFMPGEPHKPGCVVGE-PGE 140 Escherichia coli K-12
P37673        80 KIGIAIDTGNNKVsESLLEQRNIIFYHDSEHESFIEMIPGSYAIFFPQDVHRPGCIMQT-ASE 141 Escherichia coli K-12
P44583        80 NIEVGATYPNLSKyEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVVNGkTEK 142 Haemophilus influenzae Rd KW20
WP_000587470  81 AMAV-TSPENVSVtQEYDEEKDIELY-TGKVEQLVHLRAGECLITFPEDLHQPKVRIND--EP 139 Streptococcus pneumoniae
WP_000413882  82 GMTFSTQPAGAPD-TDWLADKDIAFLPEGVDEKTVILNEGDFVVFYPGEVHKPLCAVGA-PAQ 142 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap