2B3T


Conserved Protein Domain Family
prfA

?
TIGR00019: prfA 
Click on image for an interactive view with Cn3D
peptide chain release factor 1
This model describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2). RF-1 helps recognize and terminate translation at UAA and UAG stop codons. The mitochondrial release factors are prfA-like, although not included above the trusted cutoff for this model. RF-1 does not have a translational frameshift. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129130
View PSSM: TIGR00019
Aligned: 12 rows
Threshold Bit Score: 542.747
Threshold Setting Gi: 699334
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B3T_B         1 MKPSIVAKLEALHERHEEVQALLGDAQTIADQERFRALSREYAQLSDVSRCFTDWQQVQEDIETAQMMLD----DPEMRE 76  Escherichia coli
P13654         1 MKPSIVAKLEALHERHEEVQALLGDAGIIADQDRFRALSREYAQLSDVSRCFTDWQQVQDDIETAQMMLD----DPEMRE 76  Salmonella typh...
P55998         3 I---LAEKLSSILKRYDELTALLSSAEVVSDIKKLTELSKEQSSIEEISIASKEYLSVLENIKENKELLE----DKELSE 75  Helicobacter py...
P45872         1 ----MLDRLKSIEERYEKLNELLSDPEVVNDPKKLREYSKEQSDIQETVDVYRQYRDASEQLADAKAMLEek-lDAEMRD 75  Bacillus subtil...
O67032         2 LKEAYISRLDKLQEKYRKLQEELSKPEVIQDVEKYKKLSKELKELQEINELYERYKKAQKELKEAKELLKs--sDKDLRE 79  Aquifex aeolicu...
O51214         1 M---LLEKLNSATSKIKLIEEKLQDINLIKDQKKYSKIIKEYTYLEKINTKKIEYEKILSQINDTKTILEke-dQQEMKE 76  Borrelia burgdo...
P47500         3 FDKQLFFNVEKIVELTEQLEKDLNKPNLSFEQIKVINKELKHKQPLIVKFK--ELQKLVENANEAEQILNns-sLKELHE 79  Mycoplasma geni...
P75420         3 FDKQFFSSVEKIVELAEQLEKDLNKPDLTFEQIKAINKELKHKQPLVVKFK--EFKRLIDQALEAEAILEnn-eLKELHD 79  Mycoplasma pneu...
AAA63095       1 -----MQSIDVLLIEHAELELALADPELHSNPAEARKAGRRFARLAPIVATHRKLISARDDLQTARELAa---gDESFAD 72  Mycobacterium l...
P74707         2 AETYLLDKLASVEQTYQELTRMLADPDIATNPDELQRVAKARSSLEETVDTYETWKRSQEDLKGARQIVKesgnDPEMRE 81  Synechocystis s...
WP_005637988   2 MKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD----DPEMKE 77  Haemophilus
P47849         1 MKPSLIEKLKTLTYRYSEIGGLLSDSTVINDQDRYRELGKEYAQLEPIVKCFQQFQQNEKAIESAEEMQQe--kDPELRK 78  Coxiella burnet...
2B3T_B        77 MAQDELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSASEGEH 156 Escherichia coli
P13654        77 MAQEELREAKEKSEQLEQQLQVLLLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSMSEGEH 156 Salmonella typh...
P55998        76 LAKEELKILEIQKSDLETAIKQLLIPKDPNDDKNIYLELRAGTGGDEAGIFVGDLFKAYCRYADLKKWKVEIVSSSENSV 155 Helicobacter py...
P45872        76 MVKEEISELQKETETLSERLKVLLIPKDPNDDKNVIMEIRGAAGGEEAALFAGNLYRMYSRYAELQGWKTEVMEANVTGT 155 Bacillus subtil...
O67032        80 LAEEEVNRLTEEMKKLEEELKVHLVPKDPNDTKNVILEIRAGAGGEEAALFAADLFRMYQKYAEEKGWKVSILSSNKTGL 159 Aquifex aeolicu...
O51214        77 LIKQELIDLDKKKEDLEHQIKILLLPQDENDSKNIIIEIRAGTGGEEAALFANNLYSMYIKYSEKKKWKTEIINFNETEL 156 Borrelia burgdo...
P47500        80 EAKKELEKIKASLPSLEEEIKFLLLPVDENNQKNVIVEIRPAAGGDESCIFLSDLFNMYKNYCTSKNWTVELNEI-IPAS 158 Mycoplasma geni...
P75420        80 EAKKELERVRSVVPEYEEALKLLLLPIDENNQKNVIVELRPAAGGDESCIFLADLFNMYRNFCSNKGWKLQINEM-IPSS 158 Mycoplasma pneu...
AAA63095      73 ----EIAELESRIAELTTQLTDMLAPHDPHGPDDIVLEVKSGEGGEESALFAADLARMYIRYAERHGWTVTVLDETTSDL 148 Mycobacterium l...
P74707        82 MAQLEVEELENAIGELEKRLTILLLPKDPNDEKNIMLEIRAGTGGDEASIWAGDLVRMYTRYAESQGWKVSLLSESLADM 161 Synechocystis s...
WP_005637988  78 MAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQ 157 Haemophilus
P47849        79 LAEEELEQLTLKKEELEDQLKLLLVPKDPNDERNVFLEIRAGTGGNEAAIFAGDLFRMYARYAETKGWRVNIVSAHEGEH 158 Coxiella burnet...
2B3T_B       157 GGYKEIIAKI--SG-------DGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPDAElPDVNPADLRIDTF 227 Escherichia coli
P13654       157 GGYKEIIAKI--SG-------DGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPELPEAElPDINPADLRIDTF 227 Salmonella typh...
P55998       156 GGYKEIIALI--KG-------KGVYSRLKFEAGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVE-VSINPSDLKIEVF 225 Helicobacter py...
P45872       156 GGYKEIIFMI--TG-------SGAYSKLKYENGAHRVQRVPETESGGRIHTSTATVACLPEAEEVE-VDIHEKDIRVDTF 225 Bacillus subtil...
O67032       160 GGYKEVIALI--EG-------EGAYSRLKYESGVHRVQRVPVTESSGRIHTSTATVAVLPEVDETD-IKIKPEELKIETF 229 Aquifex aeolicu...
O51214       157 GGFKEIIFEI--KG-------KDVFKKLKYESGVHRVQRIPITESNGRLQTSAATVAVLPNIEETE-IDINEKDLRIDVY 226 Borrelia burgdo...
P47500       159 VGINFVSFAV--NG-------TDVFAKLKFESGVHRVQRVPLTEAKGRVHTSTVTVAVLPQLEEVE-ITINPSDLRIDTY 228 Mycoplasma geni...
P75420       159 VGLNFVSFEV--NG-------VDVFAKLKFESGVHRVQRVPATESKGRVHTSTVTVAVLPQLEAVE-VHINPADLRVDTY 228 Mycoplasma pneu...
AAA63095     149 GGYKDATLAIshKGasdgdavDGVWSRMKFEGGVHRVQRVPVTESQGRVHTSAAGVLVYPEPEEIGeVHIDESDLRIDVY 228 Mycobacterium l...
P74707       162 GGFKEAILEV--KG-------DRVYSQLKFEAGVHRVQRVPVTEAGGRVHTSTATVAIMPEVDDVE-VKIDPKDIEMSTA 231 Synechocystis s...
WP_005637988 158 GGYKEVIVKV--TG-------EGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEmPEINPADLRIDTY 228 Haemophilus
P47849       159 GGFKEVIARV--IG-------EGVYSQLKFESGAHRVQRVPVTESQGRIHTSACTVAIMPEVDEIDqIKINPAELRIDTF 229 Coxiella burnet...
2B3T_B       228 RSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGSGDRSDRN 307 Escherichia coli
P13654       228 RSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIHAAETAKRQQAEASTRRNLLGSGDRSDRN 307 Salmonella typh...
P55998       226 RAGGHGGQCVNTTDSAVRITHLPTNISVSMQDEKSQHKNKDKALKILKARLYEKQIEEQQLANAKDRKEQVGSGDRSERI 305 Helicobacter py...
P45872       226 ASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGSGDRSERI 305 Bacillus subtil...
O67032       230 RASGAGGQYVNTTETAVRITHIPTGIVVQCQDERSQFQNKQKALKILYAKLKDYYERKKQEEIAKERKEQVGTGERSEKI 309 Aquifex aeolicu...
O51214       227 RSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRARLYEFEDSKKQEQRSSNRKQQVGSGDRSERI 306 Borrelia burgdo...
P47500       229 RASGAGGQHVNRTESAVRITHLPTGIVVACQEGKSQFSNRDKAMKMLRAKLWENAQNKQLSTQADLRKSQVGSGERAEKI 308 Mycoplasma geni...
P75420       229 RASGAGGQHVNRTESAVRITHLPTGIVVSCQEGKSQFTNRDTAMKMLRAKLWEKAQNEQLSTQAGLRKSQVGSGDRAEKI 308 Mycoplasma pneu...
AAA63095     229 RSSGKGGQGVNTTDSAVRITHLPTGVVVTCQNERSQLQNKTRALQVLAARLQAMAEEQALANASADRASQIRTVDRSERI 308 Mycobacterium l...
P74707       232 RSGGAGGQNVNKVETAVDLFHKPTGIRIFCTEERSQLQNRERAMQILRAKLYDMMLQEQNDAISSNRRSQVGTGSRSEKI 311 Synechocystis s...
WP_005637988 229 RSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKI 308 Haemophilus
P47849       230 RASGAGGQHVNRTDSAIRITHLPTGVVVECQDERSQHKNKARAMSLLQSKLLAAERAKQDQEQAAKRKSLVGSGDRSERI 309 Coxiella burnet...
2B3T_B       308 RTYNFPQGRVTDHRINLTLYRLDEVMEGK-LDMLIEPIIQEHQADQLAALSEQ 359 Escherichia coli
P13654       308 RTYNFPQGRVTDHRINLTLYRLDETMEGK-LDMLIEPIVQEHQADLLAALSEQ 359 Salmonella typhimurium
P55998       306 RTYNYPQNRLSEHRINLTLYSLEEIMLSGnLDEVINPLIAHAQSQFE------ 352 Helicobacter pylori 26695
P45872       306 RTYNFPQNRVTDHRIGLTIQKLDQILEGK-LDEVVEALIVEDQASKLQ--QSE 355 Bacillus subtilis subsp. subtilis str. 168
O67032       310 RTYNFPQNRVTDHRINLTLYKLQDVLEGK-LDEIIDALRAKEIEKKLELVEKE 361 Aquifex aeolicus VF5
O51214       307 RTYNFPQNRITDHRANITLYKLEEFMQGE-LDPLLDPLMIALQEQELKSNSI- 357 Borrelia burgdorferi B31
P47500       309 RTYNYPQNRITDHRIKLTINKLNTVILGD-LDEIIEALQADEKKQQLEKFIS- 359 Mycoplasma genitalium G37
P75420       309 RTYNYPQNRVTDHRIKLTVNKLNTIILGD-LDEIIEALQADEKKQQLENFFS- 359 Mycoplasma pneumoniae M129
AAA63095     309 RTYNFPENRITDHRIGYKAHNLDQVLDGD-LDALFDALSAADKQSRLQ--QV- 357 Mycobacterium leprae
P74707       312 RTYNYKDNRVTDHRLGRN-FDLNTALEGE-IHTIIESCISQDQQERLAELAEA 362 Synechocystis sp. PCC 6803 substr. Kazusa
WP_005637988 309 RTYNYPQGRVTDHRINLTIYRLDEVMNGK-IDELIQPIITEYQADQLAALSEQ 360 Haemophilus
P47849       310 RTYNFPQGRVTDHRINLTLYQLDEVIEGD-LDPVIGPLIRELQAEQLAELSGE 361 Coxiella burnetii RSA 493
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap