2CMK


Conserved Protein Domain Family
cmk

?
TIGR00017: cmk 
Click on image for an interactive view with Cn3D
cytidylate kinase
This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]
Statistics
?
PSSM-Id: 129128
View PSSM: TIGR00017
Aligned: 9 rows
Threshold Bit Score: 291.254
Threshold Setting Gi: 9910742
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CMK_A     4 IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAA---LHHHVDVASEDALVPLASHLDVRFVSTNG--NL 78  Escherichia coli
P23863     4 IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAA---LHHHVDVASEDALVPLASHLDVRFVSTNG--NL 78  Escherichia coli
P43892     1 --MIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAA---LQRKTDLTNETDLAELARHLDIQFIPQNG--EV 73  Haemophilus influen...
P47572     1 MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVM---QVNRLNID---LFLKIINQINWRFEKDA----- 69  Mycoplasma genitali...
P75308     1 MYFQIAIDGPSSSGKSSVAKTVARQLGFEYFSTGKMYRAFAYVM---QVNRLDVN---LLLKVINQINWRFEHEK----- 69  Mycoplasma pneumoni...
O51154     1 --MIIAIDGPSASGKSSIARELGVRLNYKFISSGHLYRIITLIAqrsLMNSCDFISEDSLLNLILENDISFNNFA----- 73  Borrelia burgdorfer...
AAC23293  42 MGMIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAA---LQRKTDLTNETDLAELARHLDIQFIPQNG--EV 116 Haemophilus influen...
P38493     3 KKLSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYAA---LQENVDLTDEEKLAELLKRTDIELITTKD--GQ 77  Bacillus subtilis s...
AAA86661   5 RLPIIAIDGPAGAGKSTVTRQVADGLGLTYLDTGAMYRALAWLI---LDQGIAPEDEPAVAELTSGAEIELMPRPApqLT 81  Synechocystis sp. P...
2CMK_A    79 EVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFREL--PGLIADGRDMGTVVFPDAPVKIFLDASSEERAH 156 Escherichia coli
P23863    79 EVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFREL--PGLIADGRDMGTVVFPDAPVKIFLDASSEERAH 156 Escherichia coli
P43892    74 SILLAGMDVSRLIRTQEVADAASKVAVFQKVRSALLQLQQDFAKN--DGLIADGRDMGTVVFPNAQVKLFLDASAEERAK 151 Haemophilus influen...
P47572    70 -VYYNNADITTVITTQSVANIASKIAVDPNIRKIAVIKQQKLAEN--KNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQ 146 Mycoplasma genitali...
P75308    70 -VFYNNADISEVILNQEIAQLASNLATNPEVRKMAVLRQQALAKN--TNIVMDGRDIGTVVLKDAQLKYFLDAKPEIRAQ 146 Mycoplasma pneumoni...
O51154    74 -FLLNGENVENQILNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFsdDNYIIEGRDITTVVFPESEFKIYLDASVKVRAL 152 Borrelia burgdorfer...
AAC23293 117 NIFLAGMDVSRLIRTQEVADAASKVAVFQKVRSALLQLQQDFAKN--DGLIADGRDMGTVVFPNAQVKLFLDASAEERAK 194 Haemophilus influen...
P38493    78 KVFVNGTDVTEAIRTDEISNQVSIAAKHRSVREEMVKRQQQLGEK--GGVVMDGRDIGTHVLPNAEVKIFLLASVEERAK 155 Bacillus subtilis s...
AAA86661  82 GVKVNGQDVSDAIRTPAVTQLVSTIAAQGAVRAKLLKLQRKYGDQ--GGIVAEGRDIGTQVFPNAELKIFLTASVQERAR 159 Synechocystis sp. P...
2CMK_A   157 RRMLQLQEKG-F-SVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYA 220 Escherichia coli
P23863   157 RRMLQLQEKG-F-SVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYA 220 Escherichia coli
P43892   152 RRYKQLQNKG-I-NGNFAQILAEIKERDFRDRNREVAPLKPADDALLLDSTTLSIDEVIDQALAYI 215 Haemophilus influenzae Rd KW20
P47572   147 RRLQDMGISLsN-EKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLKEA 211 Mycoplasma genitalium G37
P75308   147 RRAQDLGIAYdS-DKAFQELVAEIKHRDAVDTSRTADPLVQAPDAIYIDSSNLTFQQVVELMVQQA 211 Mycoplasma pneumoniae M129
O51154   153 RRYKQR--NG-N-E-TLEELERTLKRRDDVDKKKQYGKLKLSKGVFYLDTSYKGLDDVCNIIIEKF 213 Borrelia burgdorferi B31
AAC23293 195 RRYKQLQNKG-I-NGNFAQILAEIKERDFRDRNREVAPLKPADDAFYYSLNSS----IISCAFFTI 254 Haemophilus influenzae Rd KW20
P38493   156 RRYEENVKKG-F-DVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILEAV 219 Bacillus subtilis subsp. subtilis...
AAA86661 160 RRLKDFEAQG-NqAVDLAQLEADIAHRDHLDSTRAIAPLQKAVDAVEIITDNLTIAEVVETIIELY 224 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap