1OTF


Conserved Protein Domain Family
taut

?
TIGR00013: taut 
Click on image for an interactive view with Cn3D
4-oxalocrotonate tautomerase family enzyme
4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 129125
View PSSM: TIGR00013
Aligned: 7 rows
Threshold Bit Score: 80.1591
Threshold Setting Gi: 499180632
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OTF_A        1 PIAQLYII-E--GRTDEQKETLIRQVSEAMANSLDAPLERVRVLITEMPKNHFGIGGEPASKVRR 62  Pseudomonas sp. CF600
CAA43229      2 PIAQLYII-E--GRTDEQKETLIRQVSEAMANSLDAPLERVRVLITEMPKNHFGIGGEPASKVRR 63  Pseudomonas sp. CF600
AAA25694      2 PIAQIHIL-E--GRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRR 63  Pseudomonas putida
EJC11290      2 PFINIKLVpEngGPTNEQKQQLIEGVSDLMVKVLNKNKASIVVIIDEVDSNNYGLGGESVHHLRQ 66  Helicobacter pylori Hp P-16
P45418        2 PFVNIRITkD--GVTAEQKKQLIAGVTQLLVDTLGKNPATTVVIIDEVETDNWGIGGESVTERRQ 64  Dickeya dadantii 3937
WP_014906660 38 PYVTVKML-E--GRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME- 98  Bacillus subtilis
WP_010878172  2 PVLIVYGPkL--DVG--KKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIADRER 62  Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap