Conserved Protein Domain Family
PTZ00431

?
PTZ00431: PTZ00431 
pyrroline carboxylate reductase; Provisional
Statistics
?
PSSM-Id: 173621
View PSSM: PTZ00431
Aligned: 3 rows
Threshold Bit Score: 504.101
Threshold Setting Gi: 124513868
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124513868   1 MENIKLGFMGLGQMGSALAHGIANANIIKKENLFYYGPSKKNTTLNYMSSNEELARHCDIIVCAVKPDIAGSVLNNIKPY 80 
221057610   1 MENIRVGFIGLGKMGSALAYGMEKSNFIGKKNIYYHTPLKKDVPFVYLQSNELVAKTCDVIVLAVKPDLAGKVLLEIKEC 80 
156101339   1 MENIRVGFIGLGKMGSALAYGIERSKLIGSQNIYYHTPVKKEAPFVYLQSNESIAKTCDIIVLAVKPDLAGKVLLEIKDY 80 
124513868  81 LSSKLLISICGGLNIGKLEEMVGSENKIVWVMPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKDMDI 160
221057610  81 VGSKLLISICGGLNLKTLEEMVGVPAKIVRVMPNTPSLVGQGCLVFCANNNVDATDTQKVIDIFSACGVIQEIKEDHMDI 160
156101339  81 AGPKLLISICGGLNLKTLEEMVGVAAKIVRVMPNTPSLVGQGSLVFCANNQVDPVDKKKVIDIFSACGDIQEIKEADMDI 160
124513868 161 ATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVEMVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNS 240
221057610 161 ATAISGCGPAYVFLFIESLIDAGVKNGLNRDVSKQLVLQTILGSVHMVKASNQAVQQLKDDVCSPGGITIVGLSTLEKHA 240
156101339 161 ATAISGCGPAYVFLFIESLIDAGVKNGLNRDVAKKLVLQTILGSVHMVKASSHPVQQLKDDVCSPGGITIVGLATLEKHA 240
124513868 241 FKYTVMNAVEAACEKSKAMG 260
221057610 241 FKYTVMDAVESACQKSKSMH 260
156101339 241 FKYAVMDAVESACQKSKSMH 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap