Conserved Protein Domain Family
PTZ00427

?
PTZ00427: PTZ00427 
isoleucine-tRNA ligase, putative; Provisional
Statistics
?
PSSM-Id: 173617
View PSSM: PTZ00427
Aligned: 3 rows
Threshold Bit Score: 2334.58
Threshold Setting Gi: 124513408
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124513408    1 MLRFVNESFLKVSNKELVHINIHISRNNLFFNKRIIRRVDNIIRvdidrlsyyisgyrvnkllsFVNFNKRIHTLRLEEM 80  
156096164    1 MLRRGASASVHIAERRALAATLKERRGGTLSRLSSLSSRGEKAK--------------------FTPSAVKLKIMEGAPG 60  
221058729    1 MLRRGARVSVYIVQRRFASVTLTQGRRGT---------RGDKAK--------------------FTPSIVNTKFMEGAST 51  
124513408   81 VTLTFTGISDNPNIVEEEERILKYWEDIDAFNLSNELSKNKKPYIFYDGPPFATGLPHYGHLLAGIIKDCVTRYFYQSNF 160 
156096164   61 THVTFEGVSENPNIVEEEQKVLAYWKSIDAFNTSNKLAENRKAYIFYDGPPFATGLPHYGHLLAGIIKDCVTRYHYQCGY 140 
221058729   52 SYVTFDGVSENPNIVEEEHKVLSYWKSIDAFNTSNKLAKGKKAFIFYDGPPFATGLPHYGHLLAGIIKDCVTRYNYQCGF 131 
124513408  161 YVERRFGWDCHGLPVEYEIEKENNINKREDILNMGIDVYNEKCRGIVLKYSKEWVATVQRIGRWIDFKNDYKTMDKSFME 240 
156096164  141 SVERKFGWDCHGLPIEYEIEKENNINKKEDILKMGIDVYNEKCRRIVLKYSNEWVKTVERIGRWIDFKNDYKTMDPTFME 220 
221058729  132 SVERKFGWDCHGLPIEYEIEKENNINKKEDILKMGIDVYNEKCRNIVLKYSNEWVKTVERIGRWIDFKNDYKTMDTTFME 211 
124513408  241 SVWWVFSELYKNNYIYKSFKVMPYSCKCNTPISNFELNLNYKDTPDPSIIISFILCSDFPKVKNV-YNIQDDIQPLVQKY 319 
156096164  221 SVWWVFSELYKRNYVYKSFKVMPYSCKCNTPISNFELNLNYKDTPDPSIIISFVLASDFPEVEEEgCPGEEVKKLLGEKL 300 
221058729  212 SVWWVFSELYKKNYVYKSFKVMPYSCKCNTPISNFELNLNYKDTPDPSVIVSFVLLSDFPSVEEE-CQVEEAKELLGEKF 290 
124513408  320 SVLYdcymksekcdtsnekhadediysdhinvnknNNKNNNSNNNNNNNTNcndnnninlnynNNCYAQHCEVFAWTTTP 399 
156096164  301 SPLY-------------------------------NQKREDGLEGGHKSTE------------GVTPPMESEILAWTTTP 337 
221058729  291 AVLY-------------------------------NEKREEWTQGESTSK-------------CVSFHGDSEILAWTTTP 326 
124513408  400 WTLPSNLALCVNEHFIYLRVYHIESQRMFIFAECRLEWIMKELKWNVENIKIVNRFLGSELKELKYKPLFTNFYEKHNFK 479 
156096164  338 WTLPSNLALCINESFTYLRIHHVKSNRVVIVGECRLEWIVKELKWDVEDLKLLNRFKGKHLKGLRYKPLFGHFYEKYNFK 417 
221058729  327 WTLPSNLALCVNENFTYLRIHHVKSNRVVIVGECRLEWVLKELKWNVEDLKIINRFKGKYLKGLRYKPLFNYFYDKYNFK 406 
124513408  480 ERAYKIIADDFVSDDAGTGIVHCAPSYGEDDYRVCCKYGIIDPESNILIDPLDWNGYFTNEVEELKDMYIKDADNVIKKK 559 
156096164  418 ERAYKILADDFVTDDAGTGIVHCAPTYGEDDFRVCKDNEVIDPEKCIFIDPIDANGYFTSEVEMVQNLFIKEADNVIKKH 497 
221058729  407 ERAYKILADDFVTDDAGTGIVHCAPTYGEDDFRVCKNNGVIDPEKSIFIDPVDANGYFTNEVEIVQNLYIKEADNVIKKY 486 
124513408  560 LKENNRLMSNNTIVHSYPFCWRSDTPLIYRAIPAWFVRVSNSTNKLVENNETTYWIPAHVKEKKFHNWIKDAKDWCISRN 639 
156096164  498 LKNENRLLSNNTIVHSYPFCWRSDTPLIYRAIPAWFIRVSNSTNELVKNNNTTYWIPHHIKEKKFHNWISDAKDWCISRN 577 
221058729  487 LKNENRLLSNNTIVHSYPFCWRSDTPLIYRAIPAWFIRVSNSTKELVKNNDTTYWIPYHIKEKKFHNWIADAKDWCISRN 566 
124513408  640 RYWGTPIPIWCDEKMETVICVESIKHLEELSGIKNINDLHRHYIDNIEIKNPKGDTYPKLKRIPEVFDCWFESGSMPYAK 719 
156096164  578 RYWGTPIPIWADEKMETVICVESIAHLEKLSGVKNVKDLHRHFIDHIEIENPKGKDHPKLKRIPEVFDCWFESGSMPYAK 657 
221058729  567 RYWGTPIPIWADEKMETVVCVESISHLEQLSGVKNISDLHRHFIDHIEIDNPKGKEYPKLKRISEVFDCWFESGSMPYAK 646 
124513408  720 VHYPFSTETNDFHKIFPADFIAEGLDQTRGWFYTLLVISTLLFNKAPFKNLICNGLVLASDGKKMSKRLKNYPDPLYILN 799 
156096164  658 VHYPFSTEKENFHKIFPADFIAEGLDQTRGWFYTLLVISTLLFDRAPFKNLICNGLVLASDGKKMSKRLKNYPDPLYILD 737 
221058729  647 VHYPFSTAKEDFQNIFPADFIAEGLDQTRGWFYTLLVISTLLFDKAPFKNLICNGLVLASDGKKMSKRLKNYPDPMYILD 726 
124513408  800 KYGADSLRLYLINSVAVRAENLKFQEKGVNEIVKSFILPYYHSFRFFSQEVTRYETTNKMQFLFNTDYIYKNDNIMDQWI 879 
156096164  738 KYGADSLRLYLINSVAVRAENLKFQEKGVNEVVKSFILPFYHSFRFFSQEVTRYECLKKKKFLFQDEYIYKNDNIMDKWI 817 
221058729  727 KYGADSLRLYLINSVAVRAENLKFQEKGVNEVVKSFILPFYHSFRFFSQEVTRYECLNKKEFLFDEIWVYKNSNIMDRWI 806 
124513408  880 FSSLQSLINSVHTEMKAYKLYNVLPKLLNFIENLTNWYIRLNRDRMRGMLGKENTHQSLNVLCRTLYLFTIIMAPFTPFI 959 
156096164  818 FSSVQMLTKLVHLEMQAYRLYNVLPKLLQFIENLTNWYIRLNRDRMRGSLGEEDCLRALCTTYRTLHLFTVLMAPFTPFI 897 
221058729  807 FSSVQKLTKHVHAEMKAYKLYNVLPKLLQFIENLTNWYIRLNRDRMRGSLGEENCLQSLCTTYKTLHLFTVLMAPFTPFI 886 
124513408  960 SEYIYQFLKNIKYTNnqnmEHNENNETTNIKEEDLNRNDIHKSVHFIMLPQVDDKYIIKYEFIELIEHMKDVILLGRNLR 1039
156096164  898 TEYIYQQLRRVVSGG----TAVSGAISGVTDGGAANGGVSHQSVHFRMLPQVDEHYSIDYGIIELIEKMKTVILLGRVLR 973 
221058729  887 TEYIYQQLRRVKSTA---------EDTGATSNGKVDRGVTDESVHFLMVPQVDENYNIDDEIIELIEKMKAVILLGRVLR 957 
124513408 1040 EKRKTPNKKPLKSLTILHKNESFFKHFDRISNYIKEELNILNVEYSNDISCLNFSAIPNFKKLGVKLGYNIKNIQNKIKN 1119
156096164  974 ERRKVASKKPLKRITILHPSKEYFQNFEQIVLYIKEELNVLHVDCSDDTSCVDFSAVPNYKTLGVKLGADLKKVQNKIKS 1053
221058729  958 ERRKVASKKPVKKITILHPTESYFVNFDQIKHYIKEELNVLQVECSNDTSCIDFTALPNYKTLGSKLGGNLKKVQNSIKN 1037
124513408 1120 MNAEDIKLFQQNKQIIIDNILLEQDDIIIQMNHNIQNDNTEAISNNYITILMDFTADQQLENMASAREICNHIQKIRKNL 1199
156096164 1054 LDSHSVRKYQAEGKITLEGVTLEGDDIIVQMKPTFQNENTDIISNDSVTLLMDFTTDQQLENMANARELCNHIQKMRKNL 1133
221058729 1038 MDSKSIKQYQMEGKITLDEVTLEGDDILIQMKPIFQDKNTDIISNETVTILIDFSTDEQLENKAIARELCNHVQKMRKSL 1117
124513408 1200 SLNQNSPVLMHIYIYDQTFKNHMLNENEYIKKCLRRNLNIIDLEKDVQNLTDKFFEEKITVNEKEVLVIFTNQ 1272
156096164 1134 SLTQNSPVKMLVYIADDALRTNMVSEMAYIRKCLRRELHVLPSQEDYNALADKMHDEEILLAGCPVRLVFAPA 1206
221058729 1118 SLNQNSPVKMHVYIADDTLRNNMVSEMEYIQKCLRRELNVVPSQEDYEGIAGKMHDEEIVLAGYPVRVVFAHV 1190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap