Conserved Protein Domain Family
PTZ00426

?
PTZ00426: PTZ00426 
cAMP-dependent protein kinase catalytic subunit; Provisional
Statistics
?
PSSM-Id: 173616
View PSSM: PTZ00426
Aligned: 3 rows
Threshold Bit Score: 661.29
Threshold Setting Gi: 124507233
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124507233   1 MQFIKNLQLNKKKDSDSSEQvlTNKKNKMKYEDFNFIRTLGTGSFGRVILATYKNGNYPPVAIKRFEKCKIIRQKQVDHV 80 
221054974   2 IQFLKNLHLHKKKDSASTKE--PKRENKMKYEDFNFIRTLGTGSFGRVILARYKNEDFPPVAIKRFEKSKIIKQKQVDHV 79 
156081692   2 IQFLKNLQLHKKKDSGSTKE--PKRKNKMKYEDFNFIRTLGTGSFGRVILATYKNEDFPPVAIKRFEKSKIIKQKQVDHV 79 
124507233  81 FSERKILNYINHPFCVNLHGSFKDDSYLYLVLEFVIGGEFFTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLK 160
221054974  80 FSERKILNYIKHPFCVNLYGSFKDESYLYLVLEFVIGGEFFTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLK 159
156081692  80 FSERKILNYINHPFCVNLYGSFKDESYLYLVLEFVIGGEFFTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLK 159
124507233 161 PENLLLDKDGFIKMTDFGFAKIVETRTYTLCGTPEYIAPEILLNVGHGKAADWWTLGIFIYEILVGCPPFYANEPLLIYQ 240
221054974 160 PENLLLDKDGFIKMTDFGFAKVVDTRTYTLCGTPEYIAPEILLNVGHGKAADWWTLGIFIYEMLVGCPPFYANEPLLIYQ 239
156081692 160 PENLLLDKDGFIKMTDFGFAKVVDTRTYTLCGTPEYIAPEILLNIGHGKAADWWTLGIFIYEILVGCPPFYANEPLLIYQ 239
124507233 241 KILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFSNIDWVNLLNKNVEVPYKPKYKNIFDSSNFE 320
221054974 240 KILEGIIYFPKFLDTNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKNVEVPYKPKYKNVFDTSNFE 319
156081692 240 KILEGIIYFPKFLDANCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKNVDVPYKPKYKNVFDSSNFE 319
124507233 321 RVQEDLTIADKITNENDPFYDW 342
221054974 320 RVQEDLTIADKITNENDPFFDW 341
156081692 320 RVQEDLTIADKITNENDPFFDW 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap