Conserved Protein Domain Family
PTZ00421

?
PTZ00421: PTZ00421 
coronin; Provisional
Statistics
?
PSSM-Id: 173611
View PSSM: PTZ00421
Aligned: 6 rows
Threshold Bit Score: 890.397
Threshold Setting Gi: 72392681
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154337944   1 MSVSRFRHSTGHVAKPQRQLLNVTSSTALWDGSNTISCNDKFVAVPWQTLGGTAVFKHDVSGRLAPNPPIVLGQEGPIID 80 
157869818   1 MSVSRFRHSTGHVAKPQRHLLNVTSSTALWDGSNTISCNDKFVAVPWQTFGGTAVFKHDTFGRLAPNPPLVLGQKGQIID 80 
146087418   1 MSVSRFRHSTGHVAKPQRHLLNVTSSTALWDGSNTISCNDKFIAVPWQTFGGTAVFKHDTFGRLAPNPPLVLGQKGQIID 80 
71424836    1 MAISRFRHTQSVPARHDRHFMNVNPSGAIWDCSNMIACNDRFLAVPWAQLGSTAVLRHTDYGKVPSSPPILLGQEGPVID 80 
71414682    1 MSISRFRHTQSVPARHDRHFINVNPSGAIWDCSNMIACNDRFLAVPWAQLGSTAVLLHTDYGKVASSPPILLGQEGPVID 80 
72392681   25 MDVSRFRHTQAVPARQDQQFLNLTPSAARWECSNLIACNDRFIAIPWLQLGSTAVLRHTDCGKLASNPPILLGQEGDIID 104
154337944  81 VKFDPFDNQKLFTASEDGSIFGWGIPTDGLKSNISSPLVELKGHRKKCGIMSFHPSAKGVLASAGVDSVINVWDVERGIA 160
157869818  81 VKFDPFNDQKLFTASEDGSIFGWGIPAEGLQSNILSPLVELKGHNKKCGIISFHPSANGVLASAGVDRVIKVWDVERGTA 160
146087418  81 VKFDPFNNHKLFTASEDGSIFGWGIPAEGLQSNISSPLVELKGHNKKCGIISFHPSANGVLASAGVDRVINVWDVERGTA 160
71424836   81 VAFNPFDPTKLFTASEDGTIMGWDIPEEGLTQSTSDHIVHLQGHTKKVGIVNFHPSAMNVLASAGADMVVNVWDVNTGKA 160
71414682   81 VAFNPFDPTKLFTASEDGTIMGWDIPEEGLTQSTSDHIVHLQGHTKKVGIVNFHPSAMNVLASAGADMVVNVWDVNTGKA 160
72392681  105 VAFNPFDSSKLFTASEDGTIMGWNIPEEGLTQNCSDNIVHLQGHSKKVGLLSFHPSAANVLASAGADMVVNVWDVQKGVA 184
154337944 161 VTTISNLSDYATGLEWNLQGSLFCTTSRDKVLRTIDPRNSTVVSSVESHASARSQRCVWCKRKDTIITLGCNKSQQRQIK 240
157869818 161 VNTISSLSDYATGLEWNLRGSLFCVASRDKTLRVIDPRDCTVVSSVESHASARSQRCIWCKRKDTIMTLGCSKSQQRQIK 240
146087418 161 VNTISNLSDYATGLEWNLRGSLFCIASRDKTLRVIDPRDCTVVSSVESHASARSQRCIWCKRKDTIMTLGCSKSQQRQIK 240
71424836  161 GEVLKCHTDQIMSLEWNLDGSLLCSTSKDKKVNIMDPRRGDIVASGSAHQGGKSQRCVWAKRQNLIVTVGFSKAQSRQVM 240
71414682  161 GEVLKCHTDQIMSLEWNLDGSLLCSTSKDKKVNIMDPRIGDIVASGSAHQGGKTQRCLWAKRQNLIVTVGFSKAQSRQVM 240
72392681  185 KEVVKCHAEQISSLDWNLDGSLLCTTSKDKKLNIVDPRSQKIVCSSGASESTKTQRALWARRADLVITIGVNTMQMRQAM 264
154337944 241 LWDTRKLEKAYSVVDLDQSSATFIPVYDEDINLLILGSKGESNVKCFELMDEGLTFSYEMSSQDPMKGLCIMPKWSLDVR 320
157869818 241 LWDTRKMESPYSVTELDQSSAAFIPMYDEDLNLLILGSKGENNVKCFELMNEGLTFSYEVNSNDPMKGLCMMPKWSLDVK 320
146087418 241 LWDTRKMERPYSVTELDQSSAAFIPVYDEDLNLLILGSKGENNVKCFELMNEGLTFSYEVNSNDPMKGLCMMPKWSLDVR 320
71424836  241 LWDARDMASPVHTEDIDQFSSLILPFFDEDTNILYIGGKGDGIIRFFELVDGRLVPCSSYDSVEAHKGLCMFPKWSLDTR 320
71414682  241 LWDARDMASPVHTEDIDQFSSLILPFFDEDTNILYIGGRGDGIIRFFELADGRLVPCSSYDSVEAHKGLCMFPKWSLDTR 320
72392681  265 VWDIRKLAAPASTVDVDQSCAVSMPFFDEDTSLFYIGSRGEGGIRSFELRNSRLINCSSYSSSEIHRGLCMVPKWMLDTH 344
154337944 321 KCEFDRLYQLTYHSLLTIEMLLPRKQSCIEFQRDVFPSTFADHSAISADEFFRGTNATPREYDLSDLFNGLSPRLLGESK 400
157869818 321 KCEFGRLYQLTYHSLFTIEMLLPRKQSCTEFQGDVFPSTFADHSAMSADEFFRGANADPREYDLSGMFDGHSPRLMGGST 400
146087418 321 KCEFSRLYQLTYHSLFTIEMLLPRKQSCTEFQGDVFPSTFADHSAISAGEFFSGASADPREYDLSGLFDGHSPRLMGGST 400
71424836  321 QCEIARFYALTPRSIYPIQMLLPRRLADSELQVDVYPPTFADVPAITAEAYFSGGNSEPLVTDMHAVFNGTEREVMRAVA 400
71414682  321 QCEIARFYALTPRSIYPIQMLLPRRLADSELQVDVYPPTFADVPAITAEAYFSGGNSEPLVTDMHAVFNGTEREVKRAVA 400
72392681  345 KCEIARFYALTQKSMYNVQMLLPRKTADEELQTDVYPPTFANEPAITADEYFSGVNKEPLVMSMQAVFDGKSLEATKAAE 424
154337944 401 SSFQKTPvaaqaakspmkepkeetvkrsEHCAVSTPAPHEGDASSTNDRTTTHVDPCGN--------MEQEENFHRKKRF 472
157869818 401 PSPEKLPvavqaakplmeapkgetttgrEKSSVSVPESSEATSAPSDDKTEKHADPCAD--------MTQRDILDKQRRL 472
146087418 401 PSPAKIPvaaqaakplkeapkgetaagrEKSSVSVPASSEATSAQGDNGPAKHADPCAD--------MTQREIFDKQRRL 472
71424836  401 LTPSGKK---------------------RHQGV-----TSAMTHSFDTNSSKYTDPMTMgveytekrRDEGILDERLGKL 454
71414682  401 LTPSGKK---------------------RHQGV-----TSAMTHSFDTNSSKYTDPMTMgveytekrRDEGILDERLGKL 454
72392681  425 TKRRGVP---------------------RPSEVESDDDDSSADEAVTSSRQKHADPNAVrg----paHSEGISSQTSSQL 479
154337944 473 QELLEKVRTCHQEIETLRKALQEKESQMLKVLEDIQSM 510
157869818 473 QELSEKVRTCHHEISALRKALHEKEAEMLQVLEDIQSI 510
146087418 473 QELSEKVRTCHQEISALRKALQEKEAEMLQVLEDIQSI 510
71424836  455 AALALELQKQEEDLKRCQEEVEKKRRIVMETVEKIRDI 492
71414682  455 AALSLELQKQEEDLKRCQEEVEKKTRIVMETVEKIRDI 492
72392681  480 LALASLLGQQQAEVQRCREDLQKKESLVMETIAKIKAL 517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap