Conserved Protein Domain Family
PTZ00417

?
PTZ00417: PTZ00417 
lysine-tRNA ligase; Provisional
Statistics
?
PSSM-Id: 173607
View PSSM: PTZ00417
Aligned: 3 rows
Threshold Bit Score: 1192.9
Threshold Setting Gi: 124513716
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156096490   1 MFSDLLPILRYHKNIGSHFYKQHSCSSAILNKNKNIICPVHCKQSFARMSEKKEHVMEGEKKVASNQPAKDKKKEEEAEV 80 
221058405   1 MFRYLLPILRYHKNFGSHFYKQHSFPLTILNKNKNIICPVNCKQTFTKMSEKKEHVMEGEKKVPSKQQVKDKKKEEEAEI 80 
124513716   3 SKSFLLSFLKY-KHVNTYIFEK-SFSKILKNTKKHIDC--HLKSCFVTMNEKKEHVLEGEKNKRVVNASKDKKKEEEGEV 78 
156096490  81 DPRLYYENRSKLILEQKAKGINPYPHKFERTITVPEFVEKYQHLASGEHLEDTPLNVTGRIMRVSASGQKLRFFDLVGDG 160
221058405  81 DPRLYYENRSKFVQEQKAKGINPYPHKFERTITVPEFVEKYQNLASGEHLENTVLNVTGRIMRVSASGQKLRFFDLVGDG 160
124513716  79 DPRLYFENRSKFIQDQKDKGINPYPHKFERTISIPEFIEKYKDLGNGEHLEDTILNITGRIMRVSASGQKLRFFDLVGDG 158
156096490 161 AKIQVLANFAFHDHTKSNFAESYDKIRRGDIVGIVGFPGKSKKGELSIFPKETIILSPCLHMLPMKYGLKDTEIRCRQRY 240
221058405 161 AKIQVLANFAFHDHTKSNFAEAYDKIRRGDIVGIVGFPGKSKKGELSIFPKETIILSPCLHMLPMKYGLKDTEIRSRQRY 240
124513716 159 EKIQVLANYSFHNHEKGNFAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRY 238
156096490 241 LDLMINENTRSTFITRTKIINYLRNFLNDKGFIEVETPTMNLVAGGASARPFITHHNDLDLDLFLRIATELPLKMLIVGG 320
221058405 241 LDLMINESTRSTFITRTKIINYLRNFLNDRGFIEVETPTMNLVAGGANAKPFITHHNDLDLDLYLRIATELPLKMLIVGG 320
124513716 239 LDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGG 318
156096490 321 IDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADFYDLIKWSEDFFSSLVMHLFGTYKILYNKDGPEKDPVEIDFTPPY 400
221058405 321 IDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADFYDLIKWSEDFFSTLVMHLFGTYKILYNKDGPDKDPIEIDFTPPY 400
124513716 319 IDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPENQPIEIDFTPPY 398
156096490 401 PKVSIVEELEKLTNTKLEQPYDSPETINKMINLIKENKIEMPNPPTAAKLLDQLASHFIENKYPNQPFFIIEHPQIMSPL 480
221058405 401 PKVSIVEELEKLTNTKLEQPFDSPETINKMINLIKENKIEMPNPPTAAKLLDQLASHFIENQYPNKPFFIIEHPQIMSPL 480
124513716 399 PKVSIVEEIEKVTNTILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFFIVEHPQIMSPL 478
156096490 481 AKYHRSKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFSAQQKDREKGDAEAFQFDASFCTSLEYGLPPTGGLGLGID 560
221058405 481 AKYHRSKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFSAQQKDREKGDAEAFQFDAPYCTSLEYGLPPTGGLGLGID 560
124513716 479 AKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGID 558
156096490 561 RIAMFLTNKNCIKDVILFPTMRPAS 585
221058405 561 RITMFLTNKNCIKDVILFPTMRPAN 585
124513716 559 RITMFLTNKNSIKDVILFPTMRPAN 583
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap