Conserved Protein Domain Family
PTZ00414

?
PTZ00414: PTZ00414 
10 kDa heat shock protein; Provisional
Statistics
?
PSSM-Id: 173604
View PSSM: PTZ00414
Aligned: 13 rows
Threshold Bit Score: 185.199
Threshold Setting Gi: 157871037
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146089520   1 MFRFTIPALKKLQPLGQRVLVKRVQPAKQTKAGILIPEQVAAKVNEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVK 80 
146089529   1 MFRFTIPALKKLQPLGQRVLVKRVQPAKQTKAGILIPEQVAAKVNEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVK 80 
71425254    1 MFRTTVSALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPTVKVDDTVLLPEFGGSSVK 80 
71425257    1 MFRTTVSALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPTVKVDDTVLLPEFGGSSVK 80 
71425263    1 MFRTTVSALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPTVKVNDTVLLPEFGGSSVK 80 
71410853    1 MFRTTVSALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPTVKVDDTVLLPEFGGSSVK 80 
71410861    1 MFRTTVSALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPTVKVDDTVLLPEFGGSSVK 80 
72390924    1 MLRVSIPALKTLQPLGSRVLVRRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPSVKVNDTVLLPEFGGSSIK 80 
72390928    1 MLRVSIPALKTLQPLGSRVLVRRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTPSVKVNDTVLLPEFGGSSIK 80 
154339207   1 MFRFTAPALKKLQPLGQRVLVKRTQAAKQTKAGVLIPEQVAGKINEGTVVAVATGSTDWTPTVKVGDMVLLPEYGGSSVK 80 
154339211   1 MFRFTAPALKKLQPLGQRVLVKRTQAAKQTKAGVLIPEQVAGKINEGTVVAVATGSKDWTPTVKVGDMVLLPEYGGSSVK 80 
157871033   1 MFRFTAPALKKLQPLGQRVLVKRMQAAKQTKAGILIPEQVAAKVNEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVK 80 
157871037   1 MFRFTAPALKKLQPLGQRVLVKRMQAAKQTKAGILIPEQVAAKVNEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVK 80 
146089520  81 VEGEELFLYDESVLLGVLSS 100
146089529  81 VEGEELFLYDESVLLGVLSS 100
71425254   81 VEGEEFFLYNEDSLLGVLQG 100
71425257   81 VEGEEFFLYNEDSLLGVLQG 100
71425263   81 VEGEEFFLYNEDSLLGVLQG 100
71410853   81 VEGEEFFLYNEDSLLGVLQG 100
71410861   81 VEGEEFFLYNEDSLLGVLQG 100
72390924   81 LEGEELFLYNEDSLLGVIQN 100
72390928   81 LEGEELFLYNEDSLLGVIQN 100
154339207  81 VEGEEFFLYEESALLGVLCN 100
154339211  81 VEGEEFFLYEESALLGVLCN 100
157871033  81 VDGEELFLYDESVLLGVLSS 100
157871037  81 VDGEELVLYDESVLLGVLSS 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap