Conserved Protein Domain Family
PTZ00409

?
PTZ00409: PTZ00409 
Sir2 (Silent Information Regulator) protein; Provisional
Statistics
?
PSSM-Id: 173599
View PSSM: PTZ00409
Aligned: 4 rows
Threshold Bit Score: 507.536
Threshold Setting Gi: 237834115
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156096088   1 MGNLMLFARRRVTKSITLEDLACMIRGCTYVVALTGSGTSAESNIPSFRGANSSIWSKYDPKIYGTIWGFWKSPEKIWEV 80 
221058807   1 MGNLMIFAKRKVTKSITLEDLASMIKECTYVVALTGSGTSAESNIPSFRGDNSSIWSKYDPKIYGTIWGFWKSPEKIWEV 80 
237834115  97 MGQAATYFQKKNTTFISFEDLADDVRKAKYVVALTGAGVSAESGIPTFRDPSDGLWKKYDPTVYATIWGFWRYPHKIWEL 176
124513310   1 MGNLMISFLKKDTQSITLEELAKIIKKCKHVVALTGSGTSAESNIPSFRGSSNSIWSKYDPRIYGTIWGFWKYPEKIWEV 80 
156096088  81 IRDISSDYEIELNPGHTALSKLESLGYLKTVITQNIDGLHEESGNSKVIPLHGSVFEARCCTCRETIQLNKIMLQKTSHF 160
221058807  81 IRDISSDYEIELNPGHTALSTLESLGYLKAVITQNIDGLHEESGNSKVIPLHGSVFEARCCTCRETIQLNKIMLQKTSHF 160
237834115 177 LLDFLRTNDPMPNAAHVALTDLQRLGYLKFIVTQNVDNLHQDSGSTNVIEYHGSLLSATCRQCGKKMRLSKSMLQD-ENF 255
124513310  81 IRDISSDYEIEINNGHVALSTLESLGYLKSVVTQNVDGLHEASGNTKVISLHGNVFEAVCCTCNKIVKLNKIMLQKTSHF 160
156096088 161 MHQLPPECPCGGIFKPNVVLFGEVIPKSLLKQAEKEIDKCDLLLVIGTSSTVSTATNLCYHAHRKKKKIVEVNISKTYIT 240
221058807 161 MHQLPPECPCGGIFKPNVVLFGEVIPKSLLKQAQKEIENCDLLLVVGTSSSVSTATNLCYYAHRKKKKIVEVNISKTYIT 240
237834115 256 AKDLPPKCACGGIFKPDVILFGEGIPANAVRDANREVDKCDLLLVVGTSASVSPASDLPYRAMRGGAKVVEVNLETTGLT 335
124513310 161 MHQLPPECPCGGIFKPNIILFGEVVSSDLLKEAEEEIAKCDLLLVIGTSSTVSTATNLCHFACKKKKKIVEINISKTYIT 240
156096088 241 NRVSDYHVRAKFSELAAISDLLKGGgaaerseaatqsggatqtgetkqrakaaqsansthSTSANR 306
221058807 241 NRLSDCHVRAKFSDLVTISDILKGEkgtligegtqggee-------aqigkashsgktkhRMNSSQ 299
237834115 336 NRISDKFVQGRASQLAQTVKALQRR----------------------------------------- 360
124513310 241 NKMSDYHVCAKFSELTKVANILKGS-----------------------------------SEKNKK 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap