Conserved Protein Domain Family
PTZ00407

?
PTZ00407: PTZ00407 
DNA topoisomerase IA; Provisional
Statistics
?
PSSM-Id: 173597
View PSSM: PTZ00407
Aligned: 6 rows
Threshold Bit Score: 1393.9
Threshold Setting Gi: 146085692
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71655841    1 MMRRTLAALEKLVIVESPNKVIKVEGLLSDPNVVPDWSFKQEHLRRLGVGAEKAVAMATTGHFMAMKEIQWTPRAISFPE 80 
157868786   1 MLRRSVRALEKLVIVESPNKVIKVEGLLSDPKVIPDWSFNNSKLRAISTGAEKAIAMATTGHFMSLKELTWSPQSSSPAS 80 
154336990   1 MLRRSVRAFEKLVIVESPNKVIKVEGLLSDPKVIPDWSFSNSKLRTISTGPEKAIAMATTGHFMSLKELTWSPQLSRPAP 80 
146085692   1 MLRRSVRALEKLVIVESPNKVIKVEGLLSDPKVIPDWSFNNSKLRAISTGAEKAIAMATTGHFMSLKELTWSPQSSSPAS 80 
71424070    1 MMRRTLAALEKLVIVESPNKVIKVEGLLSDPNVIPDWSFKQEHLRRLGVGAEKAVAMATTGHFMAMKEIQWTPRAISFPE 80 
71746782    1 MFRQTVTSLEKLVIVESPNKVIKIEGLLSNPKVIPDWSFKQGHLKCVGIGAEKAVAMATTGHFMALKEITWITHPLPPSS 80 
71655841   81 VRGAGEe----pFPPNGTVAEYTLEWQLLPGRRIQETLERYIQEKLNNVTEIILATDPDREGELIAVHALQTIKRLYPKL 156
157868786  81 GVTAAD------FPANGLLVSFSLEWELIPGRRIQDTVSHYIEEKADNLTEIIVATDPDREGELIAVHAQNLIRRMFPQL 154
154336990  81 GVTATD------FPAKGLLVSFSLEWELIPGRRIQDTVSHYIEEKADNLTEIIVATDPDREGELIAVHAQNLIRRMFPKL 154
146085692  81 RVTSAD------FPSNGLLVSFSLEWELIPGRRIQDTVSHYIEEKADNLTEIIVATDPDREGELIAVHAQNLIRSMFPQL 154
71424070   81 VRGAGEe----pFPPNGTVAEYTLEWQLLPGRRIQETLERYIEEKLNNVTEIILATDPDREGELIAVHALQTIKRLYPKL 156
71746782   81 AGGKPQeydgeaFPSSGTLAEYTLEWEPLPGRRIQETLERYIEGKVENVSEIILATDPDREGELIAVHALQTIKRLYPKL 160
71655841  157 KVPYSRAYMHSITEDGIRKAMRERLvDKCDYDLANAAETRHAMDRIFGFLGSSVVRAANSQMRSIGRVQTPALILIHERE 236
157868786 155 NAPFTRAYMHSITADGIRRAMEERH-EAFDYNLANAAEARHAMDRIFGFLGSSVVRYANPQMRSIGRVQTPALILINDRE 233
154336990 155 SVPFTRAYMHSITADGIRRAMAERH-EAFDYNLANAAEARHAMDRIFGFLGSSVVRYANPQMRSIGRVQTPALILISDRE 233
146085692 155 NVPFTRAYMHSITAEGIRRAMEERH-EAFDYNLANAAEARHAMDRIFGFLGSSVVRYANPQMRSIGRVQTPALILIKDRE 233
71424070  157 KVPYSRAYMHSITEDGIRKAMRERLvDKCDYDLANAAETRHAMDRIFGFLGSSVVRAANSQMRSIGRVQTPALILIHERE 236
71746782  161 KVPFSRAYMHSITEDGIRKAMKERSlNICDYDLASAAETRHVMDRFFGFLGSSVVRAANSQMRSIGRVQTPALILINERE 240
71655841  237 EKIAAFLEKNKTNYIVDVMCQFPGPHGTTFSQVVTINPDVKGEAS--HWATEAEARRCLHGWKLNNCSGFTVPLEPLIVP 314
157868786 234 DKIKSYLESHASTFEIQVVCYFTSKHHQRFSQVVKVTPARKGGAApvDWSDKATVKQRCEQWALSSATHFSVSPGAKPQE 313
154336990 234 DKIKSYLDSHASTFEIQAMCHFTSKHDQRFSQVVTVTPAHKGGAApvVWRDKVTVMHRCEQWALSSATQFSVSRTAKPQE 313
146085692 234 DKIKSYLDSHASTFEIQAVCYFTSKHNRRFSQVVKVTPAHKGGAApvDWSDEATVKQRCEQWALNLATHFSVSPGAKPQE 313
71424070  237 EKIAAFLEKNKTNYIVDVMCQFPGPHGTTFSQVVTINPDVKGEAS--HWATEAEARRCLNGWKLNNCSGFTVPLEPLIVP 314
71746782  241 DKISAFLERNKSTFVVEATCQFPVPHGTTFSQVVDIHSDRRGAPS--QWNTAAEANNCLEHWKLDGCHSFSIPHDPIVTP 318
71655841  315 SEVPPPQPFTMATAIAKANRHLKMSSETVSGCLQDLFQLGHITYPRTDSTRIDESALTDIYATIKKEFGKEFLyrledrt 394
157868786 314 TVTPPPKPFTMATLIARANRQLHYSSDMVSSCLQDLFQMGYITYPRTDSTRIDESILPSIYAAVRREHGKRLL------- 386
154336990 314 TVTPPPKPFTMATLIAKANRQLHYTSDMVSSCLQDLFQMGYITYPRTDSTRIDESILPSIYAAVRREHGKRLL------- 386
146085692 314 TVTPPPKPFTMATLIARANRQLHYSSDMVSLCLQDLFQMGYITYPRTDSTRIDESILPSIYAAVRREHGKRLL------- 386
71424070  315 SEVPPPQPFTMATAIAKANRHLKMSSETVSGCLQDLFQLGHITYPRTDSTRIDESALTDIYATIKKEFGKEFLyrledrt 394
71746782  319 SKVPPPQPLTMAAAITKLNRQMKLSSEMVSGYLQDLFQLGHITYPRTDSTRIDESALKDIYNAVKKNFGKEFLyrledrp 398
71655841  395 vsaPEGKKSKRTGKKNSTKQSKGADQpvgNVEDAHEAIRPTNIYADGESL-SLPPMTRAVYDLVRRNTLASFMIPMKSEK 473
157868786 387 ---QEQDGPSKAGVRRSTAQKEAADA---NVEDAHEAIRPTNIDTTVEELgAVSAPMKHIYDLVRRNTMAVHMIPMKTER 460
154336990 387 ---QEQDGAARPSSRRSAAQKETANT---NVEDAHEAIRPTNIDTTVEELgAVSAPMRHIYDLVRRNTMAVYMIPMRTER 460
146085692 387 ---QEQDGPSKSGSRRSTAQKEAADA---NVEDAHEAIRPTNIDTTVEELgAVSAPMKHIYDLVRRNTMAVHMIPMKTER 460
71424070  395 vsaSEGKKSKRTGKKNSTKQSKGAEQpvgNVEDAHEAIRPTNIYADGESL-SLPPMTRAVYDLVRRNTLASFMIPMKSEK 473
71746782  399 asgGDGKRGKKQTKKKTAKRGKNSGTpvgNVEDAHEAIRPTNINVQGDSL-SLSPETRAVYELVRRQTLAAFMIPQVVEK 477
71655841  474 IAATVKFTSGSGDKLQVVLEGKRVAEPGWTRAFQktdftaaaagaasstnnttdssvNDKNTTGVAEEVTEDITE-KEGA 552
157868786 461 IVVLVACKAANGEEVEFELQGKHVVEPGWSAAFH-----------------------GSKGTATPVTETDQDVEAvEDGG 517
154336990 461 IVVPVTCRATNGEEVEFELQGKHVVEAGWSAAFR-----------------------GDKGAVAPMAETDQDVQAlEDGG 517
146085692 461 IVVLVACKAANGEEVEFELQGKHVVEPGWSAAFR-----------------------GSKGTATPVTETDQDMEAvEDGG 517
71424070  474 IAATVKFTSGSGDKLQVVLEGKRVAEPGWTRAFQktdstaaaagaapstnnatnssvNDKNTTGVAEEVTEDITE-KEGA 552
71746782  478 IVADVKFVSGSGEKLTLTLGGKRVVEPGWTRAFHk----------------------GDSGNLSLHVGAEEGADAgDEGA 535
71655841  553 PVIRSLSQEEFRAIANLRSAL--ASLKQSRFFELRSPSVRENRPVPPLLHSEGTLIEELKNNGVGRPSTYPMIVKTLLTR 630
157868786 518 VVVPSISDDEFKAIMDIAAQRggGTGVQKGSMQLESAQVAENRPSPPLPFSEGGLIEQLKNNGVGRPSTYPMIVKTLLAR 597
154336990 518 IIVPNISDDEFKAIMDVADQRg-GAGVKKGNLRLEAAQVSENRPSPPLPFSEGGLIEQLKNNGVGRPSTYPMIVKTLLAR 596
146085692 518 VVVPSISDDEFKAIMDFATQRggGTGVKKGSMQLESAQVAENRPSPPLPFSEGGLIEQLKNNGVGRPSTYPMIVKTLLAR 597
71424070  553 PVIRSLSQEEFRAIANLRSAL--ASLKQSRFFELRSPTVRENRPVPPLLHSEGTLIEELKNNGVGRPSTYPMIVKTLLTR 630
71746782  536 PTMCSLSQEEFYAILNLRRVL--NSPNQQHLFELRSPTIRENRPVPPMPHSEGTLIEELKRNGVGRPSTYPLIVKTLLAR 613
71655841  631 GYIAVNpKGRCETTPIGRLLVSTAKSTFPSIVDIGFTATFEKKLDLIAKPNPAKRPTIlrGTNVSQADYFLSMFLSTFLN 710
157868786 598 NYITVN-KGRCETTPVGRMLVDTSRATFPSIVDIGFTSAFEKKLDRIAKPRSTKELAL--PPNVSDADYVLSSFISNFLN 674
154336990 597 NYIMVN-KGRCETTPVGRMLVETSRSTFPSIVDIGFTSAFEKKLDRIAKPGCVKELAL--PPNVSDADYVLSSFISSFLN 673
146085692 598 NYITVK-KGRCETTPVGRMLVDTSRATFPSIVDIGFTSAFEKKLDRIAKPGSAKEWAL--PPNVSDADYVLSSFISNFLN 674
71424070  631 GYIAVNpKGRCETTPIGRLLVSTAKSTFPSIVDIGFTATFEKKLDLIAKPNPAKRPTIlrGTNVSQADYFLSMFLSTFLN 710
71746782  614 GYIQVNaKGRCETTPVGRMLVETAKSTFPSIVDLGFTASFEKQLDTVAKPHPNKRPAFlrSTKISQADYVLSMFLSTFLN 693
71655841  711 YVAEATRAQRASIVERSMRLKHEQEEGSGK--DDAEFEESVANAKKKVALATGDLMALPKTCHNFTALQRGLHDYLRRHF 788
157868786 675 YVTEATKAQRVAITTRSLALQQEKRAASNTpmSPTDFQANLEKETKRVLTQVPDLVDNMKSYRTFTALQNSLNDYLRRNF 754
154336990 674 YVTEATKAQRVAIMTRSWTLQQEKSGVSST---PTDFQANLDKEKNRVMAQVPDLVDNMKNYRTFTALQNSLNDYLRRNF 750
146085692 675 YVTEATKAHRVAITTRSLVLQQEKRVASNTpmSPTDFQANLVKEAKRVLTQVPDLVDNMKSYRTFTALQNSLNDYLRRNF 754
71424070  711 YVAEATRAQRASIVERSMRLKHEQEEGSGK--DDAEFEESVANAKKKVAFATGDLMALPKTYHNFTALQRGLHDYLRRHF 788
71746782  694 YVSEAACTQRARIIERSMRLKRDQEGGSGI--GDAEFEESVVAARRKVTLASTDLVTLPKTYNNFSTLQRNLNEYLRHNF 771
71655841  789 PPSrlgSFATAPANADGNNMMMEGTsPhmiSTKHKLEKSSEV 830
157868786 755 PPS---AAAMAPASSSGTARSYGSSsSsssSTKKKESYGATY 793
154336990 751 PPS---ATAVTSVSPSGIARSYGS------SSTKKRSYGVTC 783
146085692 755 PPS---AAAVTPASSSGTARSYGSSsS---SEKKKESHGATW 790
71424070  789 PPSrlgSLATAPANADGNNMMEGTS-PhmiSTKHKLEKSSEV 829
71746782  772 PPSqvnGSPAPSPTVDAPRSRRGGA-----GTSRGVAGGG-- 806
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap