Conserved Protein Domain Family
PTZ00405

?
PTZ00405: PTZ00405 
cytochrome c; Provisional
Statistics
?
PSSM-Id: 173596
View PSSM: PTZ00405
Aligned: 8 rows
Threshold Bit Score: 218.369
Threshold Setting Gi: 71407010
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71414147    1 MPPKARPPLPPGDAAKGEKIFKGRAAQCHTGTKGGANGVGPNLYGIYGRHSGTVEGFAYSKANQDSGVIWTEEVLDVYLE 80 
71407010    1 MPPKARPPLPPGDAAKGEKIFKGRAAQCHTGTKGGANGVGPNLYGIYGRRSGTVEGFAYSKANQDSGVVWTEEVLDVYLE 80 
72393083    1 MPPKERAALPPGDAVRGEKLFKGRAAQCHTGTKGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWTPQVLDVYLE 80 
146082880   1 MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGANGVGPNLFGIVHRPSGKVEGFTYSKANAESGVVWTPEVLDVYLE 80 
154334983   1 MPPKARAPLPPGDAERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIINRKSGTIEGFAYSKANADSGVIWTPEVLDVYLE 80 
154334985   1 MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRKSGTIEGFAYSKANADSGVIWTPEVLDVYLE 80 
157867315   1 MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLE 80 
157867317   1 MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLE 80 
71414147   81 NPKKFMPGTKMAFAGLKKPQERADLIAYLATLRD 114
71407010   81 NPKKFMPGTKMAFAGLKKPQERADLIAYLATLRD 114
72393083   81 NPKKFMPGTKMSFAGLKKPQERADLIAYLETLKD 114
146082880  81 NPKKFMPGTKMSFAGIKKPQERADVIAYLETLK- 113
154334983  81 NPKKFMPGTKMSFAGIKKPQERADVIAYLETLKD 114
154334985  81 NPKKFMPGTKMSFAGIKKPQERADVIAYLETLS- 113
157867315  81 NPKKFMPGTKMSFAGIKKPQERADVIAYLETLK- 113
157867317  81 NPKKFMPGTKMSFAGIKKPQERADVIAYLETLK- 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap