Conserved Protein Domain Family
PTZ00404

?
PTZ00404: PTZ00404 
cytochrome P450; Provisional
Statistics
?
PSSM-Id: 173595
View PSSM: PTZ00404
Aligned: 10 rows
Threshold Bit Score: 713.035
Threshold Setting Gi: 66801085
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66801085    1 MELLNSLLLLFLIYLIHSFYIKNKRIHKNEAKGPIGFPLIGNMIQIGKtKPHIELMKLEKIYNQrILKIWLGDYYSVFLS 80 
166240606   1 MEFLKLILFLIIFYIIHNTYIKFKKINKNELKGPIPIPILGNLYQLTSgLPHRDLTKISEKYGG-IYRFWFADLYTVVLS 79 
111219498   2 VYLKNILIFLIIFLINPLVKKNKKSTKENDLKGPIALPIIGNLFGLRN-DTYSIMDFYHKMYGG-IYRLWFGDYFVVSLN 79 
111226486   2 IMLIKVFVLLLVVYILHNSYKKYKKLDKNELKGPTPIPVLGNLHQLSS-LPHRDLSKMTKDYGD-IFRVWFADLYTVVIS 79 
111226901   1 MEFLKLILFLIIFYIIHNTYIKFKKINKNELKGPIPIPILGNLYQLTSgLPHRDLTKISEKYGG-IYRFWFADLYTVVLS 79 
66811720    1 -MLFNIFLYLFIFCIVSSGIKKYKKIHKNELSGPFPIPLLGNLHQLGK-EPHYTLTKMHNVYGE-IFRLHFGDVYTVVVS 77 
66821897    1 MALFEIIISLFVVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGE-LPHRVLTKMTKKYGH-ILRVYMADMYTVVVS 78 
66821899    1 -MIFGIIVYLFLIYILHNAYSKYKRLNENQLPGPFPIPILGNIYQLTN-LPHFDLTKMSEKYGK-IFRIYLADLYTVIVC 77 
66823457    1 -MIFGIIVYLFLIYILHNAYSKYKRLNENQLPGPFPIPILGNIYQLTN-LPHFDLTKMSEKYGK-IFRIYLADLYTVIVC 77 
66823459    1 MALFEIIISLFVVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGE-LPHRVLTKMTKKYGH-ILRVYMADMYTVVVS 78 
66801085   81 DIDLIKDIFINKFENFSSRPKSPLTRLGTNdFRGINGSSGETWFKNKNIIVNAMKRANTKTIYTLLDNQVNDLIKEISKF 160
166240606  80 DPILIREMFVNNGDYFLDRPKIPSIRHATH-YHGIATSSGEYWLKIRDIINKAMRKTNLKLIYDSLDQQVDNLIESMNKI 158
111219498  80 DPEIIREIFIKNYSNFSSRPFLPTITFGSFnYRGISGSNGDYWKRNRNLLLNAMKKSNLKQTYDNLSDSVNSLINLMKEF 159
111226486  80 DPVLIRKIYVENHESFRDRPKIPSMKYGTY-YHGTAASMGEDWVRNRGIVSSAMRKSNIKHIYEVINNQVDVLMSTMKKY 158
111226901  80 DPILIREMFVNNGDYFLDRPKIPSIRHATH-YHGIATSSGEYWLKIRDIINKAMRKTNLKLIYDSLDQQVDNLIESMNKI 158
66811720   78 DPILIREMFVDNHENFKYRPLLPTFKFGAG-GDHGLSLSNERWERTRELVQNAMKRTSIKKIYDMLDSQVYELIKSMKQY 156
66821897   79 DPLLIREMYVDNSDIFTDRVKKPSVEHGTF-YHGTVTSYGEHWKNNREIVGKAMRKTNLKHIYELLDKQVDVLIRSMKSI 157
66821899   78 DPIIARELFVDKFDNFIDRPKIPSVKHGTF-YHGTVASMGDNWKNNKEIVGKAMRKTNLKHIYQLLDDQVDVLIESMRTI 156
66823457   78 DPIIARELFVDKFDNFIDRPKIPSVKHGTF-YHGTVASMGDNWKNNKEIVGKAMRKTNLKHIYQLLDDQVDVLIESMRTI 156
66823459   79 DPLLIREMYVDNSDIFTDRVKKPSVEHGTF-YHGTVTSYGEHWKNNREIVGKAMRKTNLKHIYELLDKQVDVLIRSMKSI 157
66801085  161 ESQNKSFNPKYYFRKFVLSTMFKYIFNEDVPYDENLengklSELTMEMENIFKTLKVGKLANSIEILETPYYYYLQKTDK 240
166240606 159 ESDGQVFEPRIYFKKYTMAAMYKFIFNEEINFNNEI-----SELIGPIEQVFKDLGSGSLFDVLLISRPLYYQWIEHTDK 233
111219498 160 QSSNESFQPDMYLRKYALTTMFKYVFNETVSFENKIvqgeeAELIDNINEAFNFMTLGNAGDFFKILQPLYYQYLLYRGG 239
111226486 159 EKRSEPFEPRYYMTKYTMAAMFKYIFNEDIGEDEDIhtgeiQKIMGPMNQVMEDFGTGSLFDVLEISQTFYLKWLELTEK 238
111226901 159 ESDGQVFEPRIYFKKYTMAAMYKFIFNEEINFNNEI-----SELIGPIEQVFKDLGSGSLFDVLLISRPLYYQWIEHTDK 233
66811720  157 QVTGNPFEIHLYAQRFTLSIMFKYIFNEDISYDEDItkgkiAELVQPMDQIFKSLGSGKLGDFISIAQPFYYQWLKFSDK 236
66821897  158 ETSGKTFDTRYYITKFTMSAMFKFLFNHDIPEDEDInkgdtQKLMGPMSEVFQNAGRGSLFDVINITQPLYLLYLEMFDQ 237
66821899  157 ESSGETFDPRYYLTKFTMSAMFKYIFNEDISKDEDVhngqlAQLMKPMQKVFKDFGTGSLFDVLEITRPLYFLYLEWFTS 236
66823457  157 ESSGETFDPRYYLTKFTMSAMFKYIFNEDISKDEDVhngqlAQLMKPMQKVFKDFGTGSLFDVLEITRPLYFLYLEWFTS 236
66823459  158 ETSGKTFDTRYYITKFTMSAMFKFLFNHDIPEDEDInkgdtQKLMGPMSEVFQNAGRGSLFDVINITQPLYLLYLEMFDQ 237
66801085  241 V----FKNIKKLIIEKYKNHNLSINPEKPRDLLDILINEYGT-TDDDVLNITQVTLDMFMAGTDTTANTLEWIIIKLCNS 315
166240606 234 N----YPKILNFLKKKYHQHLKTYNPEIQRDLLDLLIKEYYSgSDDDILTIIATINDLFLAGTDTSSASLEYMVMMLVNY 309
111219498 240 C----FNRIRTLIRNRYIEHRKTIDIENPRDLLDLLIIEYGDhSDENMISIVQVCFDVILAGVDTLASSLEWFLVMLCNN 315
111226486 239 N----FPLLLKFFNGRYEQHLETIKPESPRDLLDILINEYGTnTHDDYLNIASTVLDFFFAGTDTSSTTLEYLFLMMANY 314
111226901 234 N----YPKILNFLKKKYHQHLKTYNPEIQRDLLDLLIKEYYSgSDDDILTIIATINDLFLAGTDTSSASLEYMVMMLVNY 309
66811720  237 QfngpFSTVKKFIYKRYLEHINTIDHDNPRDLMDLLINEF-SnDKNLIPTILQTSLDMFLAGNDTTAASIIWFVLRMQEH 315
66821897  238 S----FKDIMKYHREKYNEHLKTFDPDVERDLLDILIKEYGTdNDDKILSILATINDFFLAGVDTSSTALESMVLMLTNY 313
66821899  237 H----YYQVINFGKMKIYKHLETYKPDVQRDLMDLLIKEYGTeTDDQILSISATVSDFFLAGVDTSATSLELIVMMLINY 312
66823457  237 H----YYQVINFGKMKIYKHLETYKPDVQRDLMDLLIKEYGTeTDDQILSISATVSDFFLAGVDTSATSLELIVMMLINY 312
66823459  238 S----FKDIMKYHREKYNEHLKTFDPDVERDLLDILIKEYGTdNDDKILSILATINDFFLAGVDTSSTALESMVLMLTNY 313
66801085  316 PIHQEIAYNELKKVVSSkvii---ddsiKREITLSDRPNTPYIQAIIKETMRMHPVVVFGLPRYCENDIFIgDENyFIPK 392
166240606 310 PEIQEKVYDEIKLTVNG-----------RNKVLLSDRQFTPYTVSFIKETLRYKPPSSVGVPRTTSQDIII-GDK-FIPK 376
111219498 316 QQIQDTVYNELKETVVG------------PVVTLNDRPSTPYTMACIKETIRLKAPAPFGLPHTTDQDIIV-KGH-FIPK 381
111226486 315 PEIQDKVHQEVKSYLKQi---------gKDKVELNDRQSLPYVVAVIKETLRFKPVTPFGVPRSCVNEITIdEKY-FIPK 384
111226901 310 PEIQEKVYDEIKLTVNG-----------RNKVLLSDRQFTPYTVSFIKETLRYKPPSSVGVPRTTSQDIII-GDK-FIPK 376
66811720  316 PEIQLKAYNEIKDAVGD-----------RDRVLLSDRPKTPYLNAIIKEILRLNPVGPFGLPHRSSNDIVIgNGKyFIPK 384
66821897  314 PEIQEKAFDEIKTVVNG-----------RSKVNLSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMI-GGH-FIPK 380
66821899  313 PEYQEKAYNEIKSALSSngggggggltqRNKVLLSDRQSTPFVVSLFKETLRYKPISPFGLPRSTTSDIILnNGQ-FIPK 391
66823457  313 PEYQEKAYNEIKSALSSngggggggltqRNKVLLSDRQSTPFVVSLFKETLRYKPISPFGLPRSTTSDIILnNGQ-FIPK 391
66823459  314 PEIQEKAFDEIKTVVNG-----------RSKVNLSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMI-GGH-FIPK 380
66801085  393 GCKVFINFHSIGYNEKYFKDPYKFEPNRFLENs-----------nNSMDSFFPFGLGNRVCLGRQLANDQLYLVIANLIL 461
166240606 377 DAQIFINYYGLSRNQDYFENPEQFEPSRFMNP-------------DTNIAFLPFSIGTRNCVGQNFALDEMFLAFSNIIL 443
111219498 382 DSMVLINFYSLGRNPKDFPDPLKFDPNRFIG--------------STPDSFMPFGTGPRNCIGQALGMDQIYLLLSNIFL 447
111226486 385 GAQVIINYPSIFENEKYFKNANQFDPSRFLQTtttntasneessfNSNLAFIPFSIGPRNCVGMQFAQDELFLAFANIVL 464
111226901 377 DAQIFINYYGLSRNQDYFENPEQFEPSRFMNP-------------DTNIAFLPFSIGTRNCVGQNFALDEMFLAFSNIIL 443
66811720  385 DSQILVNYRGLGFNEKYFENPSQFDPSRFLN--------------KNNDAYMPFGVGDRKCVGLQLAGDEQYLSFSNILL 450
66821897  381 NAQILINYQALGMNEEYYENPEQFDPSRFLKV-------------ESNVAFLPFSIGIRSCVGQSFAQDELYICISNILL 447
66821899  392 NAQILINYHALSRNEEYFENPNQFDPTRFLNS-------------DSNPAFMPFSIGPRNCVGSNFAQDEIYIALSNMIL 458
66823457  392 NAQILINYHALSRNEEYFENPNQFDPTRFLNS-------------DSNPAFMPFSIGPRNCVGSNFAQDEIYIALSNMIL 458
66823459  381 NAQILINYQALGMNEEYYENPEQFDPSRFLKV-------------ESNVAFLPFSIGIRSCVGQSFAQDELYICISNILL 447
66801085  462 KYKLKTIDENKINEDG-IFGLTVS-PNKYKINLESR 495
166240606 444 NFKFSSIDGKQIDETE-LYGVTLRcKNKFNVSIKKR 478
111219498 448 NFKITSENGKKLDDTDyVSGLNLK-PAKYKVCLEKR 482
111226486 465 NFTIKSVDGKKIDETI-SYGVTLKpKTRFKVLLEKR 499
111226901 444 NFKFSSIDGKQIDETE-LYGVTLRcKNKFNVSIKKR 478
66811720  451 NFNLKNI-GTPVSDYE-EFGLTLK-PNKFKVLLESR 483
66821897  448 NFKLKSIDGKKIDETE-EYGLTLKtKNRFNVTLEKR 482
66821899  459 NFKFKSIDGKPVDETQ-TYGLTLK-PNPFKVILEKR 492
66823457  459 NFKFKSIDGKPVDETQ-TYGLTLK-PNPFKVILEKR 492
66823459  448 NFKLKSIDGKKIDETE-EYGLTLKtKNRFNVTLEKR 482
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap