Conserved Protein Domain Family
PTZ00403

?
PTZ00403: PTZ00403 
phosphatidylserine decarboxylase; Provisional
Statistics
?
PSSM-Id: 173594
View PSSM: PTZ00403
Aligned: 4 rows
Threshold Bit Score: 590.286
Threshold Setting Gi: 237833861
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124507105   1 MRKGKSPSSFFSLHK-KYLLTGVTILSFIFMFQYKYHEVLTVYEDKTNVQQSSRLFWTRLLFGRTRSRITGRIFNIEIPH 79 
156097568   1 MKKNERDSNFFRLYKnKYLITGVTILSFILMFQYKYHEVLTLHDNSENASQSNKLFWARLLFGRTRSRITGEIFKIEIPN 80 
221054832   1 MKKNGRDNNFYHLYKnKYLITGVTILSFILMFQYKYHEVLTLHDNSENAVQSSKLFWARLLFGRTRSRITGQILKMEIPN 80 
237833861   1 -------------------MVGMTASAVLLTFHYKFREVIAATDNVAEIQSPSKLFYLRLLFGRTRSRITGSVMNINIMP 61 
124507105  80 SYRLYVYNFFIKYLNINKEEIKYPIESYKSLGDFFSRYIREDTRPIGDLNEYSIVSPCDSEIVDFGELTSNYLDNVKGIK 159
156097568  81 TYRLLIFNFLIKYMKINKEEIKYPIESYKSFGEFFSRYIREETRPIGDVSDYSIVSPCDSELMDYGELSSDYLENIKGVK 160
221054832  81 TYRLFIFNFLIKYMHINKEEIKYPIESYKSIGDFFSRYIREETRPIGDVSDYSIVSPCDSELIDYGELTSEYLENIKGVK 160
237833861  62 ALRDPIYRTLASVGGIDTEEIRYPLRSYKCIGHLFARTLKDKEREIEDIGTQSLASPADGVVTALGDVSSERVEQVKGAT 141
124507105 160 FNIKTFLGSDMIKKYNDDSTSFYYAIFYLSPKKYHHFHAPFNFKYKIRRHISGEVFPVFQGMFKIINNLFDINERVILSG 239
156097568 161 FNVNTFLGSNFQKKYNDGSTKFFYAIFYLSPQKYHHFHAPFNFKYKIRRHISGELFPVFQGMFKIINNLFNINERVILSG 240
221054832 161 FNVNTFLGSKFQKKHNDGSTKFFYAIFYLSPKKYHHFHAPFNFKYKIRRHISGELFPVFQGMFKFINNLFNINERVILSG 240
237833861 142 YSLRAFLGL-MPKVTNPEQNTLKFVVLHLKPKNYHHFHAPAKFDVNVLRHMTGETLPVFSSFLKRFNDIFSVNERVVMSG 220
124507105 240 EWKGGHVYYAAISAYNVGNIKIVNDEDLLTNNLRTQLSYMGGDINTKIYDHYK-DLEIGDEVGEFKVGSSIIVIFENKKN 318
156097568 241 EWKGGNVYYAAISAYNVGNIKIINDEELVTNNMRTQLSYMGGDINTKIFDSFK-SVEVGDEIGEFKMGSSIVVIFENKKD 319
221054832 241 EWKGGNVYYAAISAYNVGNIKIINDEELVTNNLRHQLSYMGGDINTKIFDSYK-SVEVGDEIGEFRMGSSIVVIFENKKD 319
237833861 221 NWKYGCMHMVAVAAYNVGNIRIDKEPSLRTNELRVVLRHLGGDVETRTYSRQPfEYSVGQHVGEFRLGSTIVLIFEAPHN 300
124507105 319 FKWNVKPNQQISVGERIGGVDQPKQPKNKFIKIRS 353
156097568 320 FSWNVQPNQTVSVGQRLGGVGEPVREKNRFIKIRS 354
221054832 320 FSWNVNQNQTVSVGQRLGGIGEPVKEENRFIKIRS 354
237833861 301 FTWDMKPGQEVRVGQRLGGVGPIRRAQTEDERLFA 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap