Conserved Protein Domain Family
PTZ00401

?
PTZ00401: PTZ00401 
aspartyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 173592
View PSSM: PTZ00401
Aligned: 5 rows
Threshold Bit Score: 1090.03
Threshold Setting Gi: 72390029
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146093564   1 MNSNHADAGAPAMEKKMSDKEARKAARLAEEKARAEEKAALVEKYKDVFGAAPMVQSTTYKSRTHIPVAKLSQPElVSKT 80 
71400970   16 ASGNVASKNAEKKQAKQNEKEARKAARLAEENARAAEKAAQLAKYADLFGAAPLLQSTTYCSKKFSEIYALTKEH-VGKT 94 
72390029   12 ANEATTANAPKSTNKKQNEKEARKAARLAEEAAKAAEKAALLLRFADVFGAAPLVQSKTYGSRKFTDIAVLSKDD-ADRV 90 
154341471   1 MSSNHAEAKAPAVEKKISDKEARKAARLAEEKARAEEKAALVEKYKDMFGAAPMVQSTAYMSHTYVPVADLSQPAlVDKT 80 
157872175   1 MSANHADAGAPAVAKKMSDKEARKAARLAEEKARADEKAALVEKYKAVFGAAPMVQSTTYKSRTHIPVSELSRPElVDKT 80 
146093564  81 VLIRARVSTTRKKGKMAFMVLRDGSDSVQAMAAVEGNVPKEMIDFMGQIATESIVDVEATVCKVEQPITSTSHSDIELKV 160
71400970   95 VTVRARVDTTRKKGKLAFMVLRDGTDSIQAMAAVAEDVPKEMVDFIGQIPCESIVDVEAIVCGVEQPITSTSQQEIELKV 174
72390029   91 VTIRARVDTTRKKGKLAFTVLRDGVHSLQAMAAVSEEVPKEMVDFIGQLPCESVVDVEGTVCIAAQPITSTSQQDIELRI 170
154341471  81 VLIRARVSTTRKKGKMAFMVLRDGRDSVQAMVAVEGDVPKEMIDFVGQIPTESIVDVEASVCKVEQSITSTSHSDIELKV 160
157872175  81 VLIRARVSTTRKKGKMAFMVLRDGSDSVQAMAAVEGDVPKEMIDFMGQIATESIVDVEATVCKVEQPITSTSHSDIELKV 160
146093564 161 KKIHTVTESLRTLPFTLEDASRKESDEGAKVNLDTRLNSRWMDLRTPASGAIFRLQSRVCQYFRQFLIDNDFCEIHSPKI 240
71400970  175 NKIHVLSEALRVLPFTLEDASRRETDEGIKINFDTRLGCRWLDLRTPASNAIFKVQSRVGQYFRQFLMDHDFVEIHSPKI 254
72390029  171 NRIHVVSEALRVLPFTLADASRREDEEGIKINFDTRLACRWLDLRSPASNAIFRIQSRVGQYFRQFLIDSEFVEIHSPKI 250
154341471 161 KKIHTVTESLRTLPFTLEDANRKESDEGAKVNFDTRLNSRWMDLRTPASGAIFRLQSRVCQYFRQFLIDSDFCEIHSPKI 240
157872175 161 KKIHTVTESLRTLPFTLEDASRKESAEGAKVNLDTRLNSRWMDLRTLASGAIFRLQSRVCQYFRQFLIDKDFCEIHSPKI 240
146093564 241 INAPSEGGANVFKLEYFNRFAYLAQSPQLYKQMVLQGDVPRVFEVGPVFRSENSNTHRHLTEFVGLDVEMRIDEHYYEVL 320
71400970  255 IAAASEGGANVFKVGYFNRDAYLAQSPQLYKQMALQGDLKRVFEVGPVFRAENSNTHRHLTEFVGLDVEMRINEHYYEVL 334
72390029  251 IATASEGGANVFKLGYFNRDAYLAQSPQLYKQIALQGDLKRVFEVGPVFRAENSNTHRHLTEFVGLDVEMRINEHYYEVL 330
154341471 241 INAPSEGGANVFKLEYFNRFAYLAQSPQLYKQMVLQGDVPRVFEVGPVFRSENSNTHRHLTEFVGLDVEMRINEHYYEVL 320
157872175 241 INAPSEGGANVFKLEYFNRFAYLAQSPQLYKQMVLQGDVPRVFEVGPVFRSENSNTHRHLTEFVGLDVEMRIDEHYYEVL 320
146093564 321 DVAESLFNYIFEHLATHTKELKNVCQQYPFEPLVWKLTPEKMKELGVGVISENVVPTDKFQARVHNMDSRMLRINYMHCI 400
71400970  335 DTAEELFCYIFAQLAKHTGELEAICRQYPFEPLLWQLTPEKIKELGVGVIEDSVEPTDIYKARVRNMGTRMLRIHYPHCI 414
72390029  331 DLAEELFCHMFERLSGHNAELEAIKRQYPFEPLVWQMSAERMKELGVGAIEEDTEPTDTYKARVRNSNLRMLRINYPDCV 410
154341471 321 DLAESLFNYMFEHLATHTKELKDVCQQYPFEPLVWKVTPETMKELGVGVISEGVEPTDKYQARVHNMDSRMLRMNYMHCI 400
157872175 321 DVAESLFNYIFERLATHTKELKNVCQQYPFEPLVWKLTPERIKELGVGVISEGVVPTDKFQARVHNMDSRMLRINYMHCI 400
146093564 401 ELLNTVLDEKMAPTDDINTTNEKLLGKLVKERYGTDFFISDRFPSSVRPFYTMECKDDVRFTNSYDMFIRGEEISSGAQR 480
71400970  415 ALLNTVLEEKLSLTDDINTTNEKLLGKLVKERYGVDFFISDLFPTAARPFYTMPFPDDERFTNSYDMFIRGEEISSGAQR 494
72390029  411 ALLNTVLETKLDPTDDINTTNEKLLGKLVKERYGVDFFISDRFPSAARPFYTMPCPNDERFTNSFDMFIRGEEISSGAQR 490
154341471 401 ELLNTVLEEKMAPTDDINTTNEKLLGKLVKERYGTDFFISDRFPSSARPFYTMECKDDARFTNSYDMFIRGEEISSGAQR 480
157872175 401 ELLNTVLDEKMAPTDDINTTNEKLLGKLVKERYGTDFFISDRFPSSARPFYTMECKDDVRFTNSYDMFIRGEEISSGAQR 480
146093564 481 IHDPDLLLARAKMLNVDLTPIKEYVDSFRLGAWPHGGFGVGLERVVMLYLGLSNVRLASLFPRDPQRTTP 550
71400970  495 IHDSSLLLKRAQSLGVDLSPIKDYVDSFRLGAWPHGGFGVGLERVVMLYLGLCNVRLVSLFPRDPQRVTP 564
72390029  491 IHDASLLLQRAQSLQVDLGPVSDYVDSFRLGAWPHGGFGVGLERVVMLYLGLHNVRLTSLFPRDPQRVTP 560
154341471 481 IHDPDLLLARAKMLNVDLTPIKEYVDSFRLGAWPHGGFGVGLERVVMLYLGLGNVRLASLFPRDPQRTTP 550
157872175 481 IHDPDLLLARAKMLNVDLTPIKEYVDSFRLGAWPHGGFGIGLERVVMLYLGLSNVRLASLFPRDPQRTTP 550
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap