Conserved Protein Domain Family
PTZ00398

?
PTZ00398: PTZ00398 
phosphoenolpyruvate carboxylase; Provisional
Statistics
?
PSSM-Id: 173589
View PSSM: PTZ00398
Aligned: 9 rows
Threshold Bit Score: 1116.01
Threshold Setting Gi: 118377471
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66357588     1 MSISNNDNEIKESRLFPVGFKKEFCTFLEKPQKIVSEK-DVILN----------KLNEPLDEDIKALELHMFGLVTSHWR 69  
221060224   28 QHGPKDDHLNDHLNDRSDERLDDAWYQVEGGDRSGERKlKFLIEgkmvetknavDFIKPLKDDIKALDFLLFDMLKDNLP 107 
209881885    1 MQINEDSSAHWESHLYPTGFKHEFCTFLDRPQKSYSSKlYETLS----------RFNEPLDEDIKALEVHMFSLVASHWR 70  
156102026   29 HQDGSHQDDSQQDWRYNPPQDSPLTAPQDSQDSQDERKlKFLIEgkmvetknavDFIKPLKDDIKALDFLLFDMLKDNLP 108 
156084500    1 ------------------MEEGDVLAALQERRKNRQEGdHV-------------DFQQPLVLDMTLLEAILFQVVRKCVP 49  
124808830    1 ------MSNNHNNFIYCSGTEDDHVNNAETGGK-EDEKlKFLIEgkmiekkgcvDFIKPLKDDIKALDFLLFDMLKDNLP 73  
118377471   39 LSGQSKQPKIHNQNFYQFSAMKRTFDLLNDQKKLKSVTnKEILLa---------NFESRVQLRYQLLNSLFQTLPVDQIN 109 
66806573     1 -MGLAGDSPYDFGEIKPDDLDKSIT-----------------------------KFQNILSNCIKDLET----------- 39  
67594757     1 MSISNNDNEIKESRLFPVGFKKEFCTFLEKPQKIISEK-DVILN----------KLNEPLDEDIKALELHMFGLVTSHWR 69  
66357588    70 Ssrkyilhgnkqk----nnidegvlspsnDGVRKIFDILKLSMNFAENEDSSSL-NQLWERIKHLDSGMLTLVVSLFNQM 144 
221060224  108 N----------------------------KLFETLCTIHDLSEKYSENQTQENF-NSLKSSIYNLDDEYLGTIVNAFGHM 158 
209881885   71 QscytssesqtpelsparipsscnekegkDGMSIIFDILKASMEFVESDNSESL-EKLWNQIRVLDSGMLSLVVSLFNQM 149 
156102026  109 N----------------------------KLFETLCAIHDLSERYSENQTEENF-KALKNSIYNLEDHYLGTIVNAFGHM 159 
156084500   50 E----------------------------DVYEKISEI-------VQHEDSGDI-KWARKKLHELDVSYWPHLARTLRII 93  
124808830   74 N----------------------------NLFEILCTIHDLSETYSENPNDDNF-LSLKNCIYNLKDEYLGTIVNAFGHM 124 
118377471  110 Etsmlipi---------------lthacqKGLESGLSPEEVIDKFFKEYDQNQIyNTEQKKI-----DFLFRVVQFVERQ 169 
66806573    40 -----------------------------DGEEIIKLVKTLILTQSPGERTTEFiEEYLKKISNLSNTEALNVSRVLSHL 90  
67594757    70 Ssrkyilhgnkqk----nnieegvsspsnDGVRKIFDILKLSMNFAENEDSSSL-NQLWERIKNLDSGMLTLVVSLFNQM 144 
66357588   145 CMITNYAESAQRIRQCRQFEReipsilsesqifsknnQSPDSDIIF---AHSLRVTIKKLLQAGFSKEHIYKLICEQEVD 221 
221060224  159 CILSNFAEWAHRGRRRKAFDM----------------SFTPNERIYgsvYETLKGTFHMLMKSGFDINEIYEQLCNQTID 222 
209881885  150 CMISNYAEAAQRIRRRRHFEKvla----------lrnENEDQDEAFrlsTHSLRNTIKDLLNAGYEKQIIYKLICEQEID 219 
156102026  160 CVLSNFAEWAHRGRRRKAFDM----------------SFTPNERIYgsvYETLKGTFHMLIKSGFDIHQIYEQLCNQTID 223 
156084500   94 CAIGNTADKAQKKRRRDAYER-----------------TNAEDSDFqgtTYTLRGSMEMFKQKGMKPEDIYQHIANMHID 156 
124808830  125 CVISNFAEWAHRGRRRKAFDK----------------SFIPNDKIYgsvNETLKGTFNILIQNGFQLNDIYEQLCNQTIE 188 
118377471  170 VVLVDALEDANYSQINDLHG-----------------------------PESLGNLIERIRRHNLD-DELLKQLSRFAVR 219 
66806573    91 LNLINVAEQHHLVRSVRE-------------------SFLNNEDDL---KYSCENTIQQLLNQGLDKESVYNALIQQKIE 148 
67594757   145 CMITNYAESAQRIRQCRQFEReipsilsesqifsknnQSPDSDIIF---AHSLKVTIKKLLQAGFSKEHIYKLICEQEVD 221 
66357588   222 LVVTAHPTQAQRISVIKCCQKIGEIMIYLDRDDLTPFEINNAKYELQRAMAMLWNVDTLRRARPTPLDEVQNTINTIEET 301 
221060224  223 FVLTTHPTQAIRTSLLKNYIQLAELLLKLDNTDKELYKKKILYDNLKTYLLAAWKTDVIRRIKPTPIDEAISLVDIVENC 302 
209881885  220 LVVTAHPTQAQRISVVKCCQNIAELILQLDRSDLTPTEIKDAKNTIQRCLAMLWNSDTLRRARPTPLDEVQNTVNTICET 299 
156102026  224 FVLTTHPTQAIRTSLLKNYIQLAELLLKLDSTDKELYKKKLLYDNLKTYLLAAWKTDVIRRIKPTPIDEAISLVDIVENC 303 
156084500  157 FVLTAHPTETHRLTSLMNHKRLCELLLQFDGQKCTPFEEASLIKDLEMHIATMWHTDQIRRQKPTLFDEIVAVAHRIKST 236 
124808830  189 FVLTTHPTQAIRTSLLKNYIRLGELLLKLDNTDKELYKKKLLYDNLKTNLLSSWKTDVIRRIKPTPIDEAISLVDIVENC 268 
118377471  220 VVLTAHPTQFYPKQVLSIINDLNEAIQSNDITQ------------IQYLLWQLAKTPFFQREKPTPLDEAQFLIQYLENV 287 
66806573   149 LVLTAHPTQIMRRTIISKNSAMGEALSSLDNQQLTMFEREDYEKRLIREVGGSWLTDEVRRSKVTVEMEAQGGFSVIEQT 228 
67594757   222 LVVTAHPTQAQRISVIKCCQKIGEIMIYLDRDDLTPFEINNAKYELQRAMAMLWNVDTLRRARPTPLDEVQNTINTIEET 301 
66357588   302 VFSTLPTFLRKIDEILNEFGMDPLPPTKTLFKYSSWVGGDRDGNPYVTAKVTRLSVINMRLRACNLFLHKIEDLMYEIPI 381 
221060224  303 IFYRIPNIIRYIDNVFYEYNLPPLKLESKICLFSSWAGGDRDGNPFVLPETTRYVCYMNKIRGCELFIPMVEKLIRDLTL 382 
209881885  300 VFNTLPQFLRNIDMILDDNGMDPLPPTKTLFKFSSWVGGDRDGNPYVTAKITRLAVTNMRLKACSIFLESIDKLMYDIPI 379 
156102026  304 IFYRIPNIIRYIDNVFYGYNLPPVKLDSKICLFSSWAGGDRDGNPFVLPETTRYVCYMNKIRGCELFIPMVEKLIRDLTL 383 
156084500  237 IFDSVPNLYEYLDAFLEEQNLPPLPLDTKLFTFSSWAGGDRDGNPFVTPDITRQTVCFNKIHACDLYLHMMERLAEELPL 316 
124808830  269 IFYRIPNIIRYIDNVLFEYNLPPVKLNSKVCIFSSWAGGDRDGNPFVLPETTKYVCYMNKIRGCELFIPMIEILIRDLTL 348 
118377471  288 FYDAVGTLQDRLRKVL-GSKFDKQKEFHKFYTLGFWPGGDRDGNPFV------RVAKLLRTSILKCYIRDVRQVKKRLSF 360 
66806573   229 LWHALPKFIKILNRCCVKYLGKELPPTFANIHVASWVGGDRDGNHNVTAEVTRQVSYFSRWIAATLYYKEIDALLFELSM 308 
67594757   302 VFSTLPTFLRKIDEILNEFGMDPLPPTKTLFKYSSWVGGDRDGNPYVTAKVTRLSVINMRLRACNLFLHKIEDLMYDIPI 381 
66357588   382 ISSHEKLREYVDNLPD-IEFYIrpvsscdtlnnsgcTTSDATVGLRPFMGFIP-----EYELYRRILHHVRIRLIASRDY 455 
221060224  383 HHCTEHFKTYVKLLEDeVSQYI--------------FDKDKKYLAQKFLWFSPfsktnKNEIYRSALLVVWAKLKSTVQV 448 
209881885  380 VSNHKKLKNYVDNLPN-ISFYLnnntp----anngdTTNDATVCLRPFMGFIA-----EHELYRRVLAHIRVRLIATRDY 449 
156102026  384 HHCTQHFKTYVKLLEDeVSQYI--------------FDPDRKYLAQKFHWFSPfsksnKSEIYRRALLVVWAKLKSVIQV 449 
156084500  317 KDATDEFKLYTSTLDKeLGAILgnm---------gaMDGIGAYFSDEFTCMMPda--qPDEVYRTLFRYIGTRLTITRYI 385 
124808830  349 HHCTQHFRSYVKLLEDeVSEYI--------------FDKDHKYLAKKFQWFSPfsksnKKEIYRRALLIVWAKLKSVVEV 414 
118377471  361 KGIYELLEEIE--------------------------------------------------------------------- 371 
66806573   309 VRHNKTLEELARHSIEkRSGTV--------------KLRYLTTLYKEFKEGIP-----SKECYRIVMAELRDKMLLTKRK 369 
67594757   382 ISSHEKLREYVDNLPD-IEFYIrpvsscdtlnnsgcTTSDATVGLRPFMGFIP-----EYELYRRILHHVRIRLIASRDY 455 
66357588   456 YlDALNFGHSVNSETRRaLAYHSTEQILEPLILMYNALEDYDHEIktnfedghlpgtni--svpwisesgsvsakLGRGL 533 
221060224  449 Y-KALISHQPVDTNFEK-LMFHSSEEFEEILMECYKSLTDSGNAL------------------------------IAEGY 496 
209881885  450 YlDTLNSGHCVQSEIRRsLAYHSTQQLLEPLLVMFEALEDYDKDIkenieedkvsasssnntipwlshsnyatakLGRGL 529 
156102026  450 Y-KSLISNQPVDPHFEK-LMFNSSDEFEEILMECYKSLCDSGNTL------------------------------IAEGY 497 
156084500  386 ArKDLANERSNVAEGIRkCVYNSVAEIMEPLKRCYASLCEVGCSM------------------------------FANSR 435 
124808830  415 Y-KSLISNQRVDEDFKK-LMFHNSDEFEEILLECYKSLVESGNTL------------------------------IAEGY 462 
118377471  372 --NDFGSNFSYKPSVSLeQLYEKLDFIRQKIITDHNG--------------------------------------LFLPI 411 
66806573   370 Y-EDLIAAKS-DTQYLPgETFENADEILQVLQVCYDSLVEVGAKE------------------------------VADGR 417 
67594757   456 YlDALNFGHSVNSETRRaLAYHSTEQILEPLILMYNALEDYDHEIktnfedghlpgtni--svpwisesgsvsakLGRGL 533 
66357588   534 LLDVIRQISAFGLSFMRLDIRQEA---SKHEKAMDEICNYLEIGN--YSEFSEEEKQEFLLNCLKSKRPL-IPYRL---- 603 
221060224  497 LKDVIRNVKIFGLHLMKLDIRQES---KKHVEAMDYICEKLQTAK--YSLLSEEEKIDFLTKILQSNRPL-IPKNIeqee 570 
209881885  530 LLDLIRQVSAFGLSLMRLDIRQEA---SKHEKAMDEVCKYIGVGS--YSEFTEEEKQNFLFKCLASKRPL-IPHRL---- 599 
156102026  498 LKDVIRNVKIFGLHLMKLDIRQES---VKHIQAMDYICEKLHIGR--YSLLSEEERIDFLTEVLQSNRPL-IPNNIeqee 571 
156084500  436 LKGVIRCLETFGLYLLRLDIRQDS---SKHTLAADYLFKKLGLSNkrYSEMLECDKVALLSDIISQKGQFgITEDMl--k 510 
124808830  463 LKDVIRNVKIFGLHLMKLDIRQES---EKHISTMNYICQKLNMKK--YSLLNEEQKINFLTDILNSNRPL-IPKNIeeee 536 
118377471  412 FENFQRKVHTFGYHFASIDIRQDSrvlDKTFKALQEKVPYMLPYN--FEELPVQQKLDLLLSLKPLNTVPqLDDEV---- 485 
66806573   418 LLDNIRRLKSFGLTLSKMDIRQES---TRHSDVINCVTEYLGLGT--YNDWDEPKKQAFLIGELESKRPL-IPHDL---- 487 
67594757   534 LLDVIRQISAFGLSFMRLDIRQEA---SKHEKAMDEICNYLEIGN--YSEFSEEEKQEFLLNCLKSKRPL-IPYRL---- 603 
66357588   604 NWSKETTEILDTFYECSHL--GAEALGSY--IISMCMKPSDILCVHVFQKEyfstisadsefhaeihdlnkfikrrsssi 679 
221060224  571 DVPNDFLNVIKTFDVCSQI--EESALGAY--IVSMCNHASDILLVEVFQKE----------------------------- 617 
209881885  600 NWTPETVEILETFRECSHL--GAEALGSY--IISMCMKPSDILCVHVFQKEyfatisaesevysklsdlntllnsrnsqd 675 
156102026  572 DVPSDFLNVINTFDVCSQI--EESALGAY--VVSMCNNASDILLVEVFQKE----------------------------- 618 
156084500  511 EAPDGVDDVVGTFKVVGEL--GTEVINAY--VISMCQEASDVLLVATFLEKia--------------------------- 559 
124808830  537 DVPNDFINVIKTFDVCSQI--EDSALGAY--IVSMCTNASDILLVEVFQKE----------------------------- 583 
118377471  486 -----LNDTLQTFNAMREIqeENGEFGSYrfIISNCRGPLDVAKVYAMSQL----------------------------- 531 
66806573   488 PCSSEVREVLDTFKVAASL--PNGSLGAY--VISMCRNPSDILAVHLLQKA----------------------------- 534 
67594757   604 NWSKETTEILDTFYECSHL--GAEALGSY--IISMCMKPSDILCVHVFQKEyfstisadsefhaeihdlnkfikrrsssi 679 
66357588   680 ssncnsngvvnvevsnvdnndsrqnggispsindspkssaaILSSIASKRMRVVPLLETVEALNNAEKTLETLLSNEWYL 759 
221060224  618 -----------------------------------------LKKNAKRKTQRVVPLLETIQSLQMSCTILENLIQNPWYR 656 
209881885  676 -------------slnmtnnlqskgqiysplnnnspksstsILPSLASKRMRVVPLLETVEALNNAQKTLEVLLSNEWYL 742 
156102026  619 -----------------------------------------LKKNAQRKTQRVVPLLETIQSLQMSCTILENLIKNPWYR 657 
156084500  560 ----------------------------------------gSQRDGVSHRVKIVPLLETIGSLRSSSDTMKCLFGNPCYR 599 
124808830  584 -----------------------------------------MKKGTQRKTQRVVPLLETIQSLQNSSIILENLLKNPWYR 622 
118377471  532 -----------------------------------------TGGWSGNSKIDVVPLFETIDDLKSADKSMKELFSNGIYQ 570 
66806573   535 --------------------------------------------VGNKNPQRVVPLFETAADLDSSPKTMEELFLQQWYL 570 
67594757   680 snncnsngvvsveasnvnnndsrqnggispsindspkssaaILSSIASKRMRVVPLLETVEALNNAEKTLETLLSNEWYL 759 
66357588   760 NYVKTVDGGIVEVMIGYSDSSKDGGRLTSGWQLYNAQERLSNIARRFGVEMVFFHGRGGSIGRGGGPQHLAILSQPPNTI 839 
221060224  657 THLRTHFDNKQEVMIGYSDSGKDGGRFTSAWELFKAQEKLVQIGKQYSVEVRFFHGRGGSVSRGGGPQHLAILSQPINTI 736 
209881885  743 NYVNSVDKGIVEVMIGYSDSSKDGGRLASAWQLYNAQECLSNISHRYGVQIVFFHGRGGSVGRGGGPQHLAILSQPPNTI 822 
156102026  658 THLRTHFDNKQEIMIGYSDSGKDGGRFTSAWELFKAQEKLVHIGKQYSVEVRFFHGRGGSVSRGGGPQHLAILSQPINTI 737 
156084500  600 DYLITYHNSTQEVMIGYSDSGKDGGRLAASWELYKAQQMLYQVAEQSAVKIRYFHGRGGSISRGGGPLHHAIMSQPRGTL 679 
124808830  623 KHLTTNFEDKQEIMIGYSDSGKDGGRLTSAWELFKAQEKLVHIGKKYSVEIRFFHGRGGSVSRGGGPQHLAILSQPINTI 702 
118377471  571 KHLK-FRKMRQTIMCGFSDGTKDGGYLGANWGIYQAKENLSKISRDYGVEAIFFDGRGGPPARGGGNKHLYYASQGPTIE 649 
66806573   571 KSI----NGEQEIMLGYSDSAKDSGRFMSCWELFKAQERLASLTEKFNVKLTLFHGRGGTAARGGGNSHEGIMSQPGGSL 646 
67594757   760 NYVKTVDGGIVEVMIGYSDSSKDGGRLTSGWQLYNAQERLSNIARRFGVEMVFFHGRGGSIGRGGGPQHLAILSQPPNTI 839 
66357588   840 TSL-MRITVQGEAITQSFGLSEIAFKTWEIYCSAILESRITALDIPnnnqcepn-------------------------- 892 
221060224  737 KNY-LRVTIQGEVITQNFCLKGMMLRSIETYISALLKCSLLKNTVS---------------------------------- 781 
209881885  823 TSF-MRITVQGEVMTQSFGLAEIAYKTWEIYTSAVLTARCSVLDLEntceefdhlenknkpiinettdksdlndtnqnyl 901 
156102026  738 KNY-LRVTIQGEVITQDFCLKGMMLRSIETYISALLKCSLLKNKVL---------------------------------- 782 
156084500  680 NNY-LRLTVQGETIGYMFALPHDCLRTMEYYLTSCIQFNVNADAIE---------------------------------- 724 
124808830  703 KNY-LRVTIQGEVITQDFCLKGMALRSVEIYMSALLKCSLLKNTLV---------------------------------- 747 
118377471  650 NHE-IQITIQGQTISSNFGVTDSCLHNLELLMSAGLQNNVLEDPKRv--------------------------------- 695 
66806573   647 KSAsTRVTIQGEMIDSHYGQIGASIRNFELFTTALLKQSLTPPPPP---------------------------------- 692 
67594757   840 TSL-MRITVQGEAITQSFGLSEIAFKTWEIYCSAILESRITALDIPnnnqcepn-------------------------- 892 
66357588   893 ------gnlgygtkVKESWRELLDQMSDISMKEYRKIVfgegnsdFTSDEFVAYFRSVTPEKEISELNLGSRPSKR---K 963 
221060224  782 --------------VKDEWRELMDEMSEITTKEYRQVV-------YENKDFVNYFRCATPQIEIGKLNLGSRPSKR---K 837 
209881885  902 ykylskmkfnknvvVSPKWRELMNKMSEVSMKEYRRIVfgednkdFTSDDFVNYFRSVTPEKEISELNIGSRPSKR---K 978 
156102026  783 --------------VKDEWRELMDEMSQLTTKEYRHVV-------YENDDFVKYFRCATPQIEIGKLNLGSRPSKR---K 838 
156084500  725 --------------VKPEWIELWDEMAEISYKAYRKVV-------RDIPGFPEYFTALTPVKEMKLMNIGSRPAKRt--K 781 
124808830  748 --------------IKKEWRDLMDEISEISTKEYRKVV-------YENKDFVKYFRCATPEIEIGKLNLGSRPSKR---K 803 
118377471  696 --------------LTQSQRDLLNELSEVSLKSYLEF--------KNHPKFMPYLLEKSPLKYYGEANIGSRPAKRsagG 753 
66806573   693 ---------------KQRWREIMEQLSITSCKKYRSVV-------RENPSFIQYFRTSTVQPEMVYLNIGSRPAKRiaaK 750 
67594757   893 ------gnlgygtkVKESWRELLDQMSDISMKEYRKIVfgegnsdFTSDEFVAYFRSVTPEKEISELNLGSRPSKR---K 963 
66357588   964 SGGIETLRAIPWVFAWTQIRSHLPVWLGLSAALEEMKKQNKLNLVTEMYENWPFVKSFFDLVSMILLKADVHIFELYNrI 1043
221060224  838 QGNVESLRAIPWVFSWTQNRMHLPVWLGIEKLYDHLIKKEKLWLIQDMYKNWPFCTSFFNLISMVMAKASLQITEEYD-I 916 
209881885  979 EGGIETLRAIPWVFAWTQIRSHLPVWLGLSAALEEMKRIDELGEIADMYQQWPFMKSFFNLVSMILLKTDVHIFQLYSkT 1058
156102026  839 QGNVESLRAIPWVFSWTQNRMHLPVWLGIEKLHDYLVERDKLPLLQDMYRNWPFCTSFFNLISMVMAKASLQIAEEYD-V 917 
156084500  782 DGGIDTIRAIPWVFGWTQVQLNMPIWLGLADGLQHAISTGRLELLKDMYRSWPFCSSFLHLVSMVLLKTNANITEEYEkA 861 
124808830  804 EGNVESLRAIPWVFSWTQNRMHLSVWLGIEKIYDYLINNNKLHIIQDMYTHWPFCTSFFNLISMVMAKASIQISQEYD-I 882 
118377471  754 EMKFEDLRAIPFVGAWSQLKQNVPGFYGLGTALKKLEAEGRLNEAADLYKDSLFFKALVQNSMMSMCKTYFPLTHY---M 830 
66806573   751 SFGLEHLRAIPWVFSFSQNRLNLPVWLGIEDAILEAKTKGWGSDINEMYKEWPFFSSTIDLVEMVLLKTDPQISLRYNqM 830 
67594757   964 SGGIETLRAIPWVFAWTQIRSHLPVWLGLSAALEEMKKQNKLNLVTEMYENWPFVKSFFDLVSMILLKADVHIFELYNrI 1043
66357588  1044 LAPPDLQKIGDLLISKLKDTIKLVMEVTKEKQLLDSDFVTRKAILLRFSWLAPCHLVQIECINRRR-------------- 1109
221060224  917 LVPEELKYIGIMLREKLKKAMELTALVTNEKIFCDNDILTKRSIESRTKWVVVCNLIQIQALKRLRerqrewelaqgkdl 996 
209881885 1059 LAPENLQHLGNLLSQKLKDTTKLVMEVTKEKQLLDSDCVTRRAILLRFAWLAPCNLVQIECINRRRk------------- 1125
156102026  918 LVPEELKYIGTMLRQKLKKAMELTALVTNEKTFCDNDLLTKRSIESRTKWVAVCNLIQIQALKRLRerqrewelaqegrl 997 
156084500  862 LVPQDYIHIGEMLRTNLMRATNLIKQVTCEREFCDHDIVVRRGFRCNARLLGPCAALQIETLVRYR-------------- 927 
124808830  883 LVPEELKYIGVLLREKLKKSMELTFLVTNEKKFCDNDQLTKRSIECRTKWVTVCNLIQIQALKRLRekeskqknenkdql 962 
118377471  831 LKDKQYSEFWNQIYNEFQETERLLLLITEQKQLLDNEPVIKQSIKLREQIVLPLLTIQQFALQRIN-------------- 896 
66806573   831 LVPAQVQPLGIEMIDELTKTTNAILELTKHKTLQQDNKILQHFVSIRRTFMDPINYIQVETLKRLR-------------- 896 
67594757  1044 LAPPNLQKIGDLLISKLKDTIKLVMEVTREKQLLDSDFVTRKAILLRFSWLAPCHLVQIECINRRR-------------- 1109
66357588       --------------------------------------------------------------------------------     
221060224  997 skknsdtptgeeqqipiqsahpnndpiapddspltpiqghtndeehklnnsltkdem--------------------dnq 1056
209881885      --------------------------------------------------------------------------------     
156102026  998 aqegglaqegglaaegglaqegglaaegghptcedhklsvssakdelesqyg---------------------------- 1049
156084500      --------------------------------------------------------------------------------     
124808830  963 dnkdnssytnithnykiyentlvtptseytnvenikqdnnqlnnsmenhnindlntlkinytenynfnkqnelfnndegk 1042
118377471      --------------------------------------------------------------------------------     
66806573       --------------------------------------------------------------------------------     
67594757       --------------------------------------------------------------------------------     
66357588  1110 -------------------------------------------------------------------KILCSSVNSSEIN 1122
221060224 1057 yggaisrkkskrihsylsrkkskliknpkyhpllepyssayiqsegdndffledlgdmdlsygrpssKSNDSTYDEVTKT 1136
209881885 1126 -------------------------------------------------------------------LCISNSNIQDPKT 1138
156102026 1050 --gpisrksskrihsylsrkkskliknpkfhpllesyssaylqsegendfffedlrdmglsygrsasKANDCTYDEVTKT 1127
156084500  928 -------------------------------------------------------------------------------N 928 
124808830 1043 hmesinknstvrinsylsrkkkkliknpkfhplielhpyvfpqsetenesffdyvktidsnferipsRNNVSTYDEATNK 1122
118377471  897 ----------------------------------------------------------------------------KDHQ 900 
66806573   897 -----------------------------------------------------------------------STQKPDGTN 905 
67594757  1110 -------------------------------------------------------------------KILCSSVNSSEIN 1122
66357588  1123 EIELSKIENALKISIQSISAGMKFTG 1148
221060224 1137 YIDYTSLNDALIVSIKAIAAGMQNTG 1162
209881885 1139 QLELEKIENALKISIQSIAAGMQFSG 1164
156102026 1128 YIDYTSLNDALIVSIKAIAAGMQNTG 1153
156084500  929 NPEDNRYHDALVISMKAIAAIMQHTG 954 
124808830 1123 FIDYTSLNDALIVSIKAIAAGMQNTG 1148
118377471  901 EDLHKSYQNLIIRSLFGSINATRNAA 926 
66806573   906 DDADPILIDTLIITFNGISAGMKNTG 931 
67594757  1123 DIELSKIENALKISIQSISAGMKFTG 1148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap