Conserved Protein Domain Family
PTZ00394

?
PTZ00394: PTZ00394 
glucosamine-fructose-6-phosphate aminotransferase; Provisional
Statistics
?
PSSM-Id: 173585
View PSSM: PTZ00394
Aligned: 5 rows
Threshold Bit Score: 1136.14
Threshold Setting Gi: 71665273
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154331175   1 MCGIWGYANHNVQRTVEQILDVLIRGIQKVEYRGYDSAGLAIDAGIGSENDGGAAASAPTPRPCVVRSVGNVSQLREKVF 80 
157864312   1 MCGILGYANSNVPRTVEQILSILLCCIQKVEYRGYDSAGLAIDANIGSDKEDGTAASAPTLRPCVVRSVGNVNQLREKVF 80 
146071703   1 MCGILGYANSNVPRTVEQILDILLCCIQKVEYRGYDSAGLAIDANIGSGKEDGTAASAPTPRPCVVRSVGNINQLREKVF 80 
71665273    1 MCGIFAYINYHKRQTVREIFNVLLDGLQRVEYRGYDSAGLCID---------GQDADQP---PVLIRSVGNIAQLRKIVF 68 
72391770    1 MCGIFGYILHRIPCTTRDVLNVLLDSLQRMEYRGYDSAGLCVD-------------DVKSKKHIVVRSVGNISKLRERVF 67 
154331175  81 SRAVAATLPPMDAKTSHHIGIAHTRWATHGDVCERNCHPQQSNNGEFTIVHNGIVANYATLKELLKAEGYAFFSDTDTEV 160
157864312  81 SEAVAATLPPMDATTSHHVGIVHTRWATHGGVCDRNCHPQQSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEV 160
146071703  81 SEAVAATLPPMDATTSHHVGIVHTRWATHGGVCERNCHPQQSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEV 160
71665273   69 SDE-TVSLVDLDASFDVHVGIAHTRWATHGMPSVKNCHPQASNDQGFVVVHNGIMTNFMPVKQMLLERGYHFSGDTDTEV 147
72391770   68 SGCADL---DFNAQLENHEGIAHTRWATHGPPSEANCHPQASNNMEFVVVHNGIITNFMTIKQMLLEEGYHFSSDTDTEV 144
154331175 161 ISILSEYLYTRKGIHNLVDLTLELSRLVEGSYALLIKSIYFPGQIAASRKGSPLMVGIRQTDDYGCVMKVSTYDLPDLWK 240
157864312 161 ISVLSEYLYTRKGIHNFADLLLEVSRMVEGSYALLVKSVYFPGQVAASRQGSPLMLGIRRTDDRGCVMQLQTHDLTDLSG 240
146071703 161 ISVLSEYLYTRKGVHNFADLLLELSNMVEGSYALLVKSVYFPGQVAASRQGSPLMVGIRHTDNRGSVMKLQTYDFTDPSG 240
71665273  148 IAVLLEYLHTQEPKLSLVELATRITSMLEGAYALLVKSMFFPNELIACRKSSPLMVGFRRGGPSGAVANGDALPLT---- 223
72391770  145 IVVLAEHIFSMDHSISFADLAGKVMAELDGAYALLIKSVHFPGELIACKEASPLVIGLQNGKSNGTASGIANGSVMN--- 221
154331175 241 SHEVFFASDWSSFVEYTNNVVHLEDDDVAHYCDGTLRFYKAEGRSSST---------VKREVQYLDAKPESLSKGNYPHF 311
157864312 241 PLEVFFSSDSNAFAEYTRDVVYLEDSDIVHYCDGALRFYNAAERQRSI---------IKREVQHLQTKLENLSKGNYAHF 311
146071703 241 PLEVFFSSDPNAFAEYTRDVVYLEDNDIVHYCDGALRFYNAAERQRSI---------IKREVQHLETKLESLSKGNYAHF 311
71665273  224 --ELYFASDANSFIAHTREVIFLENGDIAHFHDGALALYATSNTTAGLnnsvavatpVSRAPQIIDATPEGLSKDGYEHF 301
72391770  222 --KLFFSSDVASFLPYTQEVIFLEDGDVAHYSKGALTLYNDATP-------------VSRTSQTVDVSPEGLCKGAYPSF 286
154331175 312 MLKEIYEQTESVISSIHGRIDFSSGTVRLSGFTLQSIRAILTSRRILFIACGTSLNSCLAVRLLFEELVP-LPISVENAS 390
157864312 312 MLKEIYEQAESVISTMHGRVDFSSGTVQLSGFTQQNIRVILTSRRILFIACGSSLNSCIAVRPLFEELVP-LPISVENAS 390
146071703 312 MLKEIYDQAESVISSMHGRIDFSSGTVQLGGFTQQSIRAILTSRRILFIACGSSLNSCIAVRPLFEELVP-LPISVENAS 390
71665273  302 MLKEIYEQPESVTRTMRGRINFLKGDVNFDGMDASILAALSRAHCLMLISCGTSYHSCLAVRPIFEELLRnLSVVVENAP 381
72391770  287 MLKEIYEQPESVSRSMRDRIDFNTREVTIKEMSDGVRTTLLSARRLMLVACGTSFHSCVAARPIFEELLPnISITLENAP 366
154331175 391 DFLDRKPPIQRDDVCFFVSQSGETADTLLALRLCFEAGAVCVGITNAVDSSISRLTHYCIPLNAGVEVSVASTKAYTSQV 470
157864312 391 DFIDRRPQVQRNDTCFFISQSGETADTLMALKLCSEAGAMCVGITNVVESSISRLTHCGIHLKAGVEVGVASTKAYTSQV 470
146071703 391 DFIDRRPQMQRNDTCFFISQSGETADTLMALKLCSEAGAMCIGITNVVESSISRLTHCGIHLKAGVEVGVASTKAYTSQV 470
71665273  382 YFMDRQPRVHRDDICVFVSQSGETADTIMALQYSKAAGATLIGVTNVPGSTVSRQTDYAISLNAGVEVGVASTKAYTSQI 461
72391770  367 DLLDREPRIGSDDVCIFVSQSGETADTLMALQYCKKYEAMIVGLTNVPGSSVLRLSDFALLLNAGVEVGVASTKAYTSQV 446
154331175 471 VVLTLVALLLS--------------------------------DDSVRLQERRQEVVRGLAEMPVKISEALKITHDSVKA 518
157864312 471 IVMTLVALLLS--------------------------------SDSVRLQERRNEILRGLSEVSARIAEVLRITHDPVKA 518
146071703 471 IVMTLVALLLS--------------------------------SDSVWLQERRNEILRGLSEVSAKIAEVLRITHDPVKA 518
71665273  462 VLLTLLALLMSqttnsswndkettknirgnteenkkeveegkeENNQYVQKRRAEIISGLAALPAAISQCLKFVSDAVIS 541
72391770  447 VVLTLLALFLSkencsgn-------------------sshshgGSQSPIQKRRLEIIDGLAALPGALSHCLKCTNDVATK 507
154331175 519 LAARLKESSSILVLGRGYDLATAMEAALKVKEVSYVHTEGINSGELKHGPLALIDDTLPVLAMCTNNRHFHLSKTAVQQV 598
157864312 519 LAARLKESRSIIVLGRGYDLATAMEAALKVKELSYVHTEGIHSGELKHGPLALIDETVPVLAMCTSDKHFDLSKAAVQQV 598
146071703 519 LAARLKESHSVIVLGRGYDLATAMEAALKVKELSYVHAEGIHSGELKHGPLALIDETVPVLAMCTNDKHFGLSKAAVQQV 598
71665273  542 IAEEWHDASTILVIGRGYDYPTALESALKVKEVSYVFTEGIHSGELKHGPLALVDANSRVIAFCAHDRHFERGKSAIQQV 621
72391770  508 LAEELCDAKAILILGRGYDYATALEAALKVKELTYIHTEGIHCGELKHGPLALVDEHSTIVAFCPHDKFLGRSKSAIQQV 587
154331175 599 SARKGAVVVFATEADAELKAAAREIILVPNTVDCLQCVVNIIPFQLLAYYMALLRGNNVDYPRNLAKSVTVQ 670
157864312 599 NARNGAVVVFATEVDAELKAAASEIVLVPKTVDCLQCVVNVIPFQLLAYYMALLHGNNVDCPRNLAKSVTVQ 670
146071703 599 NARNGAVVVFATGVDAELKAAASEIVLVPKTVDCLQCVINVIPFQLLAYYMALLRGNNVDCPRNLAKSVTVQ 670
71665273  622 KARGGRVVAITTQKDAEVENATTLCVEVPKVVDCLQGVVNVVPLQLLAYYLAVRRGHNVDCPRNLAKSVTVQ 693
72391770  588 KARGGRVVAITTEPDAELVSATSRCVEVPAIVDCLQGIVNVVPLQLLAHHLAVRRGLNVDCPRNLAKSVTVQ 659
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap