Conserved Protein Domain Family
PTZ00384

?
PTZ00384: PTZ00384 
choline kinase; Provisional
Statistics
?
PSSM-Id: 173576
View PSSM: PTZ00384
Aligned: 13 rows
Threshold Bit Score: 598.686
Threshold Setting Gi: 71031158
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84994672   3 HLTVVSEHDFQHKDPV-KTPENEGYFLN-----EKETNEVKSLCIRHVPFWNNIAKEKIDLKIVSGALTNRVYQATLVDG 76 
84994668   1 MLNSNYDTSLGLEHEN-KTKFDSLTFKY-----DHSHSNLKSLCIRHVPFWNNVNPEFIEIKKMNNGVTNRVYQATLVDG 74 
84994670   1 MLNSNYDTSLGLEHEN-KTKFDSLTFKY-----DHSHSNLKSLCIRHVPFWNNVNPEFIEIKKMNNGVTNRVYQATLVDG 74 
84994674   1 MLNSNYDTSLGLEHEN-KTKFDSLTFKY-----DHSHSNLKSLCIRHVPFWNNVNPEFIEIKKMNNGVTNRVYQATLVDG 74 
84994676   1 MLNSNYDTSLGLEHEN-KTKFDSLTFKY-----DHSHSNLKSLCIRHVPFWNNVNPEFIEIKNVNTGIFNSVYILRLISP 74 
84994678   3 VKNLSKDSSRYITYSQ-KTRLYIKTDKNsqkikDQDQTNIKSLCIRHVPFWNNVNPEFIEIKTMYNGITNQVYQATLVDG 81 
84994680   1 MLNSNYDTSLGLEHEN-KTKFDSLTFKY-----DHSHSNLKSLCIRHVPFWNNVNPEFIEIKKMNNGVTNQVYQATLVDG 74 
71031158   1 ---------------------------------------------------------------MIDGITNQVYRLSLTIP 17 
71031160   2 LNFPNRDTLPGLEHDN-KTKFDSLTFKY-----DYSHSNLKSICIQHVPFWTNINPDFIEVKDANAGIFNRVYIIKLNSS 75 
71031162   1 --------------MV-LEKLSSLTFKY-----DNSHSNLKNLCIQHVPFWNNLKHESITVKIMIDGITNQVYRLSLTIP 60 
71031164   3 QVTGVSEHSFQHNDQV-KTSENEGYFLN-----ETETNEVKTVSLKYVPLWNSLTDDKLELKIISCALTNRVYLVTLVKE 76 
71031166   2 LTSSNHGSSLGLEQHN-KIKFGSLTFKY-----DNSHSNLKNLCIQHVPFWNNLNHECIKVEPMLNGITNQVYRLSLTIP 75 
71031168   2 LNPPNYDDSSGLEQQSfKTKLSSLSFKY-----DNSHTNLKNLCIQHVPFWNDLNHESLEVKTMMNGVTNQVHMVTLTPP 76 
84994672  77 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSFQNLSVLTGIASSL 156
84994668  75 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 154
84994670  75 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 154
84994674  75 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 154
84994676  75 NKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 154
84994678  82 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 161
84994680  75 DKDRYPIKSVCIKKSSTYNSLVIDDDLQYRIAKLLGDNNFGPRIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSL 154
71031158  18 D-NTYAIKSVCVKKTSTYNSLVFDNDLQYNVAKLLGDNNFGPKIIGRFGDFTIQEWVEGDTLTNDSLQNLSVLTGIASSL 96 
71031160  76 DKDKYPYKKITLKKKADFNSLVVNNDLQYNVAKLLGDNNFGPKIIGRFGDFTIQEWVEGDTLTNDSLQNLSVLTGIASSL 155
71031162  61 D-NTYAIKSVCVKKTSTYNSLVFDNDLQYNVAKLLGDNNFGPKIIGRFGDFTIQEWVEGDTLTNDSLQNLSVLTGIASSL 139
71031164  77 DKDKYPYKKLIVKKRTDFNSLVVDNDVQFNIAKLLGDNNFGPKIIGRFGDFTIQNWVEGNTMEIECFQNLSVLTGIASSL 156
71031166  76 D-NTYAIKSVCVKKTSTYNSLVFDNDLQYNVAKLLGDNNFGPKIIGRFGDFTIQEWVEGDTLTNDSLQNLSVLTGIAASL 154
71031168  77 YKDRYPLKSVCIKKSTTYNSLAFDNDVQYNVAKLLGDNNFGPKIIGRFGDFTIQEWVEGDVMEIESLRNISVLTGIASSL 156
84994672 157 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 236
84994668 155 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLGFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 234
84994670 155 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLGFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 234
84994674 155 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 234
84994676 155 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 234
84994678 162 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 241
84994680 155 AKFHKKVTELVPKEWDRTPMFLTKIATWSPHVERIIKKYNLDFDYNELVQNYEMFKKILNNHLNTSNSITNSILFCHNDL 234
71031158  97 AKFHKRVTELVPKEWDRTPMFLTKISVWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSIANSVLFCHNDL 176
71031160 156 AKFHKRVTELVPKEWDRTPMFLTKISVWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSIANSVLFCHNDL 235
71031162 140 AKFHKRVTELVPKEWDRTPMFLTKISVWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSISNSVLFCHNDL 219
71031164 157 AKFHKRVTELVPKDWDRTPMFLTKLSVWSQHIERIIKKYNLDFDYNELVQNYELFKKIFNNHLNSSQSTTNSVLFCHNDL 236
71031166 155 AKFHKRVTELVPKEWDRTPMFLTKISVWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSIANSVLFCHNVL 234
71031168 157 AKFHKRVTELVPKEWDRTPTFLTKISLWSQHVERIIKKHNMDFDYNEMTQNFELFKKILTNHLNSSNSIANSVMFCHNDL 236
84994672 237 FSLNILDFNQGIYFIDFDFAGFNYVGWEIANFFVEVTILYDpPKPPYFISSEEYNLSEEMKTIFISVYLSQLLGQNVLPS 316
84994668 235 FFTNILDTLHGIYFIDFDYAGFNYVGWDIANFFKIIYILLD-PLMKYYLYHNTSPVKDEFKPLFISVYLSQLLGQNVLPS 313
84994670 235 FFLNIVDFNQGVYFIDFDYCGFNYVGWDIANFLLKILHILHdPLCHSYTSISPY-ISEEMKTIFTSVYLSQLLGKNVLPS 313
84994674 235 YPSNILHTNQGIYFIDFDFSGFNYVGWEISHLFFKLCIVYNhHTPPYFNFDDSLALSQEMKTIFISVYLSQLLGKNVLPS 314
84994676 235 FFTNILDTLHGIYFIDFDFSGFNYVGWDIANFFLKPGIVHEsHTTPQFYFDDSLSLSDEMKTIFISVYLSQLLGQNVLPS 314
84994678 242 YLDNILDFNQGIYFIDFDYSGFNYVGWEISHLFFKLCIVYNhHTPPYFNFDDSLALSQEMKTIFISVYLSQLLGKNVLPS 321
84994680 235 YPSNILHTNQGIYFIDFDYCGFNYVGWEIASLFNKMYIIYDrVRKCYLSHNTS--FAKEFKSLFTSVYLSQLLGQNVLPS 312
71031158 177 YTQNILDFNQGIFFIDFDYSAFNYVGCDIATLFFKLRLVYNtVSHPYFDLDDSLALTKEMKSLFVSIYLSQLLGRNVSPS 256
71031160 236 FFTNILDINQGMYLIDFDFAGFNYVGWEIANFFLKPGIVHLnDPPAQFYLDDSLALTNEMKTFFVSVYLSQLLGRNVLAS 315
71031162 220 FFSNILDINQGIYLIDFGFAGFNYVGWEIASFFKKMYLIYD-DVRHTYSSCPSPCLSDEMKTFFVSVYLSELLGKNVSPS 298
71031164 237 FSLNILDFNQGIYFIDFDFAGFNYVGWEIASFFVEVTILYDpPTPPYFISSKEYHLSEEKKSLFVSVYLSQLLGRNVLAS 316
71031166 235 YNTNVLETQHEVCFIDFDFAGFNYVGWEIANLFVKLCVVYNdDSPPYTNEFDSNVLTNEIKSFFVSVYLSQLLGRNVLAS 314
71031168 237 FFTNILEFNQGIYFIDFDFAGFNYVGWEIASFFRIIYIVYD-PLGKYLLYHNTPPVEEEFKPIFLSVYLSQLLGKNVSPS 315
84994672 317 DDLVNDFLQSLEIHTLGVNLFWTYWGIVMSDKPKNELSKPVKLEAYAMFQYNLFRNNIRRLTDNKIVNT 385
84994668 314 DDLVNDFLQSLEIHTLGVNLYWIYWSLIMTDKPKIDPSNSVKFEGYAMFQYNLFRNNIRRLTDNKIVNT 382
84994670 314 DDLVNDFLRSVEIHTLGVNLFWTYWGIVMNDKPKNELSKPVKLEAYPMFQYNLFRNNIRRLTDNKIVNT 382
84994674 315 DDLVNDFLQSVEIHTLGVNLFWTYWGIVMTDKPNNELSNPYSFIAYSKFEYYSLKIKFDKLISN----- 378
84994676 315 DDLVNDFLQSLEIHTLGVCLFWIYWSIIMSDKPKNEHKFVVLFHVKGELIYNLFRNNIRRLTDNKIVNT 383
84994678 322 DDLVNDFLQSVEIHTLGVNLFWTYWGIVMTDKPKNEFNAAIDCPLQAKLNHNLLEINIRKFTDSRILT- 389
84994680 313 DDLVKDFLQSVEIHTLGVHLFWIYWGIVIMDKPRQSTVIP-GIYIESKLWINLFKSLVKNLVSKI---- 376
71031158 257 DDVVKEFLQSVEIHTLGVHLFWTYWGIVMNEKPKNELSGPIDFPDQAKLNHNLLIIDLKKFSDNNIFT- 324
71031160 316 DDVVKEFLQSLEIHTLGVNLFWTYWGIVMSDKPKNQLNFDVLFHVQSELMYNLFKTNLRRLTDNKIINF 384
71031162 299 DDAVGEFLRSLEIHILGTRLFWTYWGIIMNEKPVDELSKAYSFIAYSKFEYDLLKNELYKFSSIQSSL- 366
71031164 317 DDVVREFLQSVEIHT--------------SDKPKNELSKPVKLDAYGMFQYNLFKSNLRKLTDEKIVNF 371
71031166 315 DDVVKEFLQSLEIHTLGVNLFWTYWGIVMNDKPKNELSRPVKLYVHGFFEYNLFKSNLKKLNDDEIVNY 383
71031168 316 DDVVKEFLQSLEIHSLGVYFYSTYLGIIMYDKLNNEVSKPTTFDHFAIFQYNLFKSLLSNFSDSKM--- 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap