Conserved Protein Domain Family
PTZ00382

?
PTZ00382: PTZ00382 
Variant-specific surface protein (VSP); Provisional
Statistics
?
PSSM-Id: 173574
View PSSM: PTZ00382
Aligned: 10 rows
Threshold Bit Score: 101.56
Threshold Setting Gi: 159107067
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159107067  1 MAAAVCTACDSGKVPNKDGSGCVTCSVGDCKSCVVDDVCEECNSGFSLDSsgASCVSSGANRSGLSTGAIAGISVAVVAV 80 
159114006  1 MTAAVCTSCDSGKKPNKDGSGCVVCSDTNCKSCVVDGVCGECNSGFSLDN--GKCVSMSTNKSGLSTGAIAGISVAAVVV 78 
159109847  1 MTPAVCTSCDSDKKPNKDGSGCVVCSDTNCKSCVVDGVCGECNSGFSLDN--GKCVSSGANRSGLSAGAIAGISVAVVAV 78 
159108546  1 MAPAICTSCDSGKKPNRDGTGCVLCSDTNCKSCVMDGVCGECSDGYSLEG--GRCVSSGSNRSGLSTGAIAGISVAVIVV 78 
159107077  1 MAAAVCTSCDSDRKPNRDGSGCVLCSVGGCKSCVVDGVCGECNSGFSLDN--GKCVSSGANRSGLSAGAIAGISVAVVAV 78 
159107122  1 MAAAVCTSCDSDRKPNRDGSGCVLCSVGGCKSCVVDGVCGECNSGFSLDN--GKCVSSGANRSGLSAGAIAGISVAVVAV 78 
159107193  1 MTAAICTSCDSDKKPNKDGTGCVTCSVGDCKSCVVDDVCGECNSGFSLDN--GKCVSSGANRGGLSTGAIAGISVAVVVV 78 
159107211  1 MTPAVCTSCDSDKKPNKDGSGCVVCSDTNCKSCVVDGVCGECNSGFSLDN--GKCVSSGANRSGLSAGAIAGISVAVVAV 78 
159107259  1 MTPAICTSCDSDKKPNKDGTGCVLCSVGDCKSCVVDDVCGECVDGYSLDSsgTSCVSMSTNRSGLSTGAIAGISVAVVVV 80 
159107317  1 MTPAVCTSCDNSKKPNKDGSGCVLCSDTNCKSCVMDGVCGECNSGFSLDN--GKCVSSGANRSGLSTGAIAGISVAVIAV 78 
159107067 81 VGGLVGFLCWWFVCRGKA 98 
159114006 79 VGGLVGFLCWWFVCRGKA 96 
159109847 79 VGGLVGFLCWWFVCRGKA 96 
159108546 79 VGGLVGFLCWWFICRGKA 96 
159107077 79 VGGLVGFLCWWFVCRGKA 96 
159107122 79 VGGLVGFLCWWFVCRGKA 96 
159107193 79 VGGLVGFLCWWFVCRGKA 96 
159107211 79 VGGLVGFLCWWFVCRGKA 96 
159107259 81 VGGLVGFLCWWFICRGKA 98 
159107317 79 VGGLVGFLCWWFVCRGKA 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap