Conserved Protein Domain Family
PTZ00380

?
PTZ00380: PTZ00380 
microtubule-associated protein (MAP); Provisional
Statistics
?
PSSM-Id: 173572
View PSSM: PTZ00380
Aligned: 14 rows
Threshold Bit Score: 189.17
Threshold Setting Gi: 154335952
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146084580   1 MCAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKAHFLALPRDATVAELEAAVRQALSTSVKKVTLAIEGSAP 80 
146084585  40 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKAHFLALPRDATVAELEAAVRQALSTSVKKVTLAIEGSAP 119
146084590   1 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKAHFLALPRDATVAELEAAVRQALSTSVKKVTLAIEGSAP 80 
154335952   1 MSAYQSSNTAEARRAECARLQAKYPGHVAMVVEAAK--SSKAHLLALPRDATVAELEAAVRQALGISAAKVTLAVEGCTP 78 
157868218   1 MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKEVTLAIEGSTP 80 
157868230   1 MSAYHSSNPVEARRAECARLQAKYPGHAAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKEVTLAIEGSTP 80 
157868232   1 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTP 80 
157868234   1 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTP 80 
157868236   1 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTP 80 
157868238   1 MSAYHSSNPVEARRAECARLQAKYPGHVAVVVEAAEKAGSKVHFLALPRDATVAELEAAVRQALGTSAKKVTLAIEGSTP 80 
146084580  81 AVTAAVGDIADACKRDDGFLYVSVRTEQAMGGIAGLCFASD 121
146084585 120 AVTAAVGDIADACKRDDGFLYVSVRTEQAMGAFASPCLSVA 160
146084590  81 AVTAAVGDIADACKRDDGFLYVSVRTEQAMGVSATLCFSTY 121
154335952  79 AATASVGDVADACKHADGFLYVSVRGEQAMGIF-SLCFPFF 118
157868218  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGAFASPCLSTY 121
157868230  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGAFASPCFSVA 121
157868232  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGGIAGLCFASD 121
157868234  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGGIAGLCFASD 121
157868236  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGAFASPCFSVA 121
157868238  81 AVTATVGDIADACKRDDGFLYVSVRTEQAMGGIAGLCFASD 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap