Conserved Protein Domain Family
PTZ00378

?
PTZ00378: PTZ00378 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173571
View PSSM: PTZ00378
Aligned: 6 rows
Threshold Bit Score: 750.937
Threshold Setting Gi: 154343605
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146097171   2 SSSVSWQRYDDEFHVSGVLTEAARACVSAHPTDVKDFFSRYFREVAGGTSVKALHHNEVLSAAGETAITFTLELCVGPEV 81 
157874437   2 SSSVSWQRYDDEFHVSGVLTEAARACVSAHPTDVKDFFSRYFREVAGGTSVKALHHNEVLSAAGETAITFTMELCVGPEV 81 
154343605   2 SGSVSWQRYDNEFNVSGILTEAARACVSTYPVDVKDFFFRYFREAAQGTSVKAIYHNEVLSAAGETAVTFTVELCAGPEI 81 
71654206    1 MELLSWKRYDDKYKLSQILTEAARSCVDAHTARPEEYLAAYFTEKCSGDEIRGIVTRAVYLPSGTVVLRLTLQLLNGMET 80 
71400677    1 MELLSWKRYDDKYKLSQILTEAARSCVDAHTARPEEYLAAYFTEKCSGDEIRGIVTRAVYLPSGTVVLRLTLQLLNGMET 80 
74026264    1 MESVSWKLYDNQHDLSGILTLAARSCVDSRALRPIEYLAAYFSTKCTGDEIRTLSAHVMFAPGGCRVLRIILRLLNGMEV 80 
146097171  82 SvtTGDSLSFADRGRDGEACASLAASEGVTDAEGNRYsviqttcaaaVSKLLQLGHAEpQCEWDSALRAAISTSPLANGA 161
157874437  82 SvtTGDLLASADRGRDGEARASLAASEGATDAEGNSYsaiqttcaaaVSKLLQLGYAEpQHEWDSALRAALSTSPLANGT 161
154343605  82 SvvTGDLLSCVTSDRDGENHASLAAAEESTGDEDNGYsviqttcaavVSKLLQLGYVEpQREWDSTLGAALSASPVAIGA 161
71654206   81 E--SAAFVQPSHGEYDAGADETTDPTTYTTEALQKSY----------FPRLLQFGARD-QKGFDTTLRQISSSAETVDVG 147
71400677   81 E--SAAFVQPSHGEYDAGADETTDPTTYTTEALQKSY----------FPRLLQFGARD-QKGFDTTLRQISSSAEAVDVG 147
74026264   81 Q--SSALLSASQELGDSLVEHTVDPAV-IHEVLQESY----------FPRLVPCRACD-QRQFDEILSRVAATPDLPNVG 146
146097171 162 SALQWVLSIMASLVAAKQRCVPLHHYVAALIddrrsggpaaggahlalsqngvsaastaraGSYTSVRPYSVPQLLVTFL 241
157874437 162 SALQWVLSIMASLVVAKQRCMPLHQYIAALIddrrsggpavrgahstpartgvsaastaraGSDTSARSYSVPQLLVTFL 241
154343605 162 SSIQWALSIMASLVAAKQRRVPLHLYVAALVddsrsgepivggahltpgraglsavskelvDSSASSRQYPVPQLLVTFL 241
71654206  148 VSVMHGLSTVAASAAARCSSIPLFMYLRQLF------------------------------PSLGGDEVFAMPQLCISFF 197
71400677  148 VSVMYGLSTVVASAAARCSSIPLFMYLRQLF------------------------------PSLGGDEAFTMPQLCISFF 197
74026264  147 TAVVHALSVVASAAASRCTSTPAFQYLRNTF------------------------------GLLTDVETFSMPQLCIDFF 196
146097171 242 VRAAGSDAPEAAHGVRFSHVYvaldaltspvgdangaekpmpVSGAVLRQRMQKVRQAAERFAQSHptSSSVDTRGGLHW 321
157874437 242 VRAARSDAPEAVHSVRFSHVYvaldvltssvgdasgveksmpVSGAVLRQRMQKVRRAAQRFVQSHptSSSVGTGGTLHW 321
154343605 242 VSSAQGDAPDAVTGVRFSHVYvaldvltasvdgayeaerlkpVSGTVLRRRMRRVRKAAHLFLQSHptSSSVCASGALHW 321
71654206  198 GPGNPSTARLALKDVLLIPAM---------------------PEGSIPNEIIQKIFAAFHHFCRAH--NTMMRSDGSLAY 254
71400677  198 GPGNPSTARLALKDVLLIPAM---------------------PEGSIPNEIIQKIFAAFHHFCRAH--NTMMRSDGSLAY 254
74026264  197 GPENVATARVALKSVLILPCM---------------------PNGTVSHEVMQKIFAAFNHFRKVH--NAATRSDGSLVF 253
146097171 322 DGAANLTDVVKAVTEALSDAQLNVGAEVCVGLSMRASTT--QVPAANTADGGAAKNASGDCRVLYSLFgGGEPPVTGDQL 399
157874437 322 DGAVNLTDVVKAVTEALSGAQLNVGAEVCLGLSMKASTT--RVPAANTADGGAAKDAPGECRVLYSLFgGGEPPVTGDQL 399
154343605 322 DGAANLADVVKAVTEALSAAQLKVGTEVCVGLSMDASTT--RVPEVAAADGGTIKDTAGDCTVLYNLFgDGEPPVTGDQV 399
71654206  255 DDFENVTDALGLAEEAVRAVGLTPVKDICIGLRFAAAVTspSLAATAVPSAAAWKESKDTTEVMYALF-PGDADVSGAQV 333
71400677  255 DDFENVTDALGLAEEAVRAVGLTPVKDICIGLRFAAAVAspSLAATAVPSAAAWKESKDTTEVMYALF-PGDADVSGAQV 333
74026264  254 STFDNITDAINLADEVLRAVELRPQTDVCLGLRLAAPAT------------RTQKEAKDGGEVFYSMF-PGEQDITGSQL 320
146097171 400 SEYVKEQLKEVdPDIVQFLEDTHAMEDCVARQRLQMALQDSIVLSDM-VAGQRESGPAASGLASSLPvpahdgafPNIVM 478
157874437 400 SEYVKEQLKEVgPDIVQFLEDTHVMEDCVARQRLQMALQDSIVLSDV-VAGQREAGSAASGLASPLPvqahdgafPNSVM 478
154343605 400 SEYVKEQLRAVdPDIVQFLEDTHAMEDRAARQRLQMALQDSIVLSDV-VASKPEWRTATSSPPDALLvppydgafPNIVI 478
71654206  334 SEYLREQLQNC-TDFVVYVEDTHCDRDTFGLQRLQAHLGDLLHVSGRdIYARSQYKKVEHGIRGLWT--------SNFVL 404
71400677  334 SEYLREQLQNC-TDFVVYVEDTHCDRDTFGLQRLQAHLGDLLHVSGRdIYARSQYKKVEHGIRGLWT--------SNFVL 404
74026264  321 AEYVREQVQAS-ANLVVYVEDTHCDVDTIGLRRLHATIGGTAVFSGYdLYRRSKYEKVEQGLDELWT--------SNVVL 391
146097171 479 NPCDCGTISDVIEYMCATGEDSRRAVTVLVGTAAGDPQTAAHvvdLAIAGGASYvLVSAGVFSAHTAAAVSRLASRTDEL 558
157874437 479 SPCDCGTVSDVVDYVCATGEDSRRAVTVLVSTAAGDPQTAAHvvdLAIAGGASYvLVSAGIFSAHTAAAVSRLATRTDEL 558
154343605 479 NPCDYGTISGVVKCMCAAGADSRRAVTVLVDTAAGDAQTAAHlvdVAIACGASYvLDSAGIFSAHVAAVVSQLASRTDEL 558
71654206  405 DPGAIGTLSDVHEIVRRVKEFEGRCVSFATQELVGNAATMAH---LSVAMEARF-LCMGGLLSTPQCEVLSHLISIQSEL 480
71400677  405 DPGAIGTLSDVHEIVRRVKEFEGRCVSFVAPELVGNAATMAH---LSVAMEARF-LCMGGLLSTPQCEVLSHLISIQSEL 480
74026264  392 EASAIGSLSALCDNVRMVRRHEGCTIALAPQSLMHNVAFAVH---LAVGVGARF-LCVGGLMDVVQCEVVSQYLYVQDEL 467
146097171 559 TSMQMVAPrpSAQRFNRYDWPPLPTAEVAPIRRKGDKKKkdiskansKRK 608
157874437 559 TSMQMVAPrpSAQRFNRYDWPPLPTAEVAPIRRKGDKKKkdigkansRRK 608
154343605 559 TLKNMAAPrlPAQRFNRCDWPPLPTVEVAPIRRKGDKRKkdagkastKRK 608
71654206  481 LHSRALFR--EAPKVARMELPKPPMDVVPEIKRRTDKKK--------RKK 520
71400677  481 LHSRALSR--EAPKIARMELPKPPTDVVPEIKRRMDKKK--------RKK 520
74026264  468 EQSRLLLE--EAPKPPCAVLPDAPTDTVPEIKRRLDKKK--------RKK 507
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap