Conserved Protein Domain Family
PTZ00359

?
PTZ00359: PTZ00359 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173552
View PSSM: PTZ00359
Aligned: 10 rows
Threshold Bit Score: 646.474
Threshold Setting Gi: 156087444
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156085771   1 MPGIKAGIGPYSDEAAPKVADQVRYLMPIAKLLFILVAILGFGFCMAMLLIATVEGIQLKAMQPGEFK-AKNADMTALSI 79 
156089811   1 MPGIRAGIGPYSDEAAPKVADSVRYLMPIAKLLFILVAILGFGFCMAMLLIATVEAIEIKALSPNEGK-LKNADMTALSI 79 
156087473   1 MPDIKAGIGPYSDEAAPKVANQVRYLMPIAKLLFILVAILGFGFCMAMLLMATVEAIQLKAMQDGEFK-DKNADMTALSI 79 
156087444   1 MPEIKEGIGCYAEKYVPLVP------LTGITITFLVVAVLGLGFYCALMINCIVAVFEKWVIQSEKLElLKSETKTPLSF 74 
156087446   1 MPGIRAGIGPYSDEATPKVADSVRYLMPIAKLLFILVAILGFGFCMAMLLIATVEAIQLQAMTPTEFK-LKNADMTALSI 79 
156085769   1 MPGIKEGIGCYAEKYVPLVP------LTGITITFLVVAVLGLGFYCALMINAVVEAFG--NLMTEKPTlLKSETKTPLSF 72 
156082612   1 MPGIKAGIGPYSDEAAPKVANQVRYLMPIVRLLFILVAILGFGFCMAMLLMATVEAIEIQALKTGEYK-LKNADMTALSI 79 
156084106   1 MPGVKAGIGPYSDEAAPKVADSVRYLMPIAKLLFILVAILGFGFCMAMLLMATVEAIEIKALTNGEGK-LKNADMTALSI 79 
156083389   1 MPGIRAGIGPYSDEATPKVADQVRYLMPIAKLLFILVAILGFGFCMAMLLMATVEAIEIKALSTSQYK-LKNADMTALSI 79 
156083391   1 MPEIKEGIGCYAEKYVPLVP------LTGMTITFLVVAVLGLGFYCALMINCLLSILQKWA-KYEKVKlLKSETKTPLSF 73 
156085771  80 AICLSHLALHFLGYQCRFMKLRWTSWDSGLFILGFVVVISAFFAVFVMVMPTDGINVGKDDAy--GGVRAYIAMGFTGLE 157
156089811  80 AIVLSHLALHFLGYRCRFMKLHWTSWDSALFILGFAVVISAFFAVFIVVMPDNGINIVQDKD---KHFRAYGAMGFTGLE 156
156087473  80 AIVLSHLALHFLGYKCRFMKLHWTSWDSGLFILGFVVVISAFFAVFIVVMPGKDATLGEDKQ----GIRPYGAMAFTGLE 155
156087444  75 LIMVMYILLHVYGYKCSFVETPICRRRVLFIGLGFVVVLCSFVAVMLATIPDDWVKKINLDThfnAQHRVYGAMGFSGLQ 154
156087446  80 AICLSHLALHFLGYRCRFMKLHWTSWDSGLFILGFVVVIAAFFAVFIVVMPAEGIKLLPDSK----GIRPYGAIAFTGLE 155
156085769  73 LIMVMYILLHVYGYKCSFVETPICRRRALFIGLGFVVVFCSFVAVMLATIPEEWLEPTGLQSyvkAEHRVYGAMGFSGLQ 152
156082612  80 AICLSHLALHFLGYQCRFMKLHWTSWDSGLFILGFAVVISAFFAVFIVVMPDDGIKITEDTNk--KSYRAYGAMGFTALE 157
156084106  80 AICLSHLALHFLGYRCRFMKLHWTSWDSGLFILGFAVVISAFFAVFIVVLPGKGTNLGKFEK---DDNRTYIAMGFTGLE 156
156083389  80 AICLSHLALHFLGYRCRFMKLHWTSWDSGLFILGFAVVISAFFAVFIVVMPTVGTILGKDES----KIRPYGAMAFTGLE 155
156083391  74 LIMVMYILLHVYGYKCSFVETPICRRRVLFIGLGFVVVFCSFVAVMLATIPEEWLKPAGLNTrinAKHRVYGAMGFSGLQ 153
156085771 158 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFAAHAYTLYDLKERPN-----DYGDKETTWHKHRFMAAANYI 232
156089811 157 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFAAHAYTLKELKDNNG-----DYGKDNKTWHHHRFMAAVNYI 231
156087473 156 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFAAHAYTLYDLKENNA-----NYGDKDTTWHHHRFMAAANYI 230
156087444 155 IIALVGFIIAAYKQHCFGKCMTRSRKAFYVIAILNLIHLIGYIVNLGMFYKDGKveekmTTMESKEEWKVYQGRATLNYL 234
156087446 156 LLAMFGFIICAMKTHCFGGCMTLSKKVFYTFAFIYMLVFAAHAYTLKELQDNPS-----KYGENDTTWHKHRFMAAANYI 230
156085769 153 IIALVGFIIAAYKQHCFGKCMTRSRKAFYVIALLNLIHLLGYIVNLGLFYKNGKvetemKQMKDKEEWKVYQGSATLNYL 232
156082612 158 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFAAHAYTLYELKEKNG-----EYGKDNKTWHHHRFMAAANYI 232
156084106 157 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFSAHAYTLYEFKENPE-----EYGNDDKNWHKHRFMAAVNYI 231
156083389 156 LLAMFGFIICAMKTHCFGGCMTLNKKVFYTFAFIYMLVFAAHAYTLKELEENKD-----KYGENDTTWHHHRFMAAVNYI 230
156083391 154 IIALVGFMFAAYKQHCFGKCMTRSRKAFYVIAVLNLIHLIGYIVNLGMFYREGKlqeemSTMKDKEEWKVYQGRATLNYL 233
156085771 233 FVIGLCISAYQVNLCCMSFTKCDGVFIFLTGTVVGILITVCLSM----FPDITQEQWTLVGLIAMLYILTVALFLYIHAK 308
156089811 232 FVIGLCISAYQVNLCCMSFTMCDAVFIFLTGTVIGILITTCLSM----FPEITQQQWTLVGLIAMLYILTVALFLYIHAK 307
156087473 231 FVIGLCISAYQVNLCCMSFTKCDAVFIFLTGTVVGILISVCLSM----FPEIVQQQWTLVGLIAMLYILTVALFLYIHAK 306
156087444 235 LLIALVISAYQVNMCCTPFNSYEGIFLLFGGAVIGCIICAMLACefdnTRRDKHYEHTIYPIMFLLLVFTGLWLYCLHAA 314
156087446 231 FVIGLCISAYQVNLCCMSFTKCDAVFIFLTGTVVGILITVCLSM----FPEITQEQWTLAGLIAMLYILTVALFLYIHAK 306
156085769 233 LLIALVISAYQINMCCTPFNGYEGIFLLFGGAVIGCIICAMLACemdnAPAKRHYEHAIYPILFLLLVFTGLWLYCLHAA 312
156082612 233 FVIGLCISAYQVNLCCMSFTKCDAVFIFLTGTVVGILITVCLSM----FPEINTQQWTLVGLIGMLYILTVALFLYIHAK 308
156084106 232 FVIGLCISAYQVNLCCLSFTKCDAVFIFLTGTVVGILITICLSM----FPEIQPTQWTLAGLIGMLYILTVALFLYIHAK 307
156083389 231 FVIGLCISAYQVNLCCMSFTKCDAVFIFLTGTVVGILITVCLSM----FPEIDTKQWTLVGLIAMLYILTVALFLYIHAK 306
156083391 234 LLIALVISAYQVNMCCTPFNGYEGIFLLFGGAVIGCIICAMLACemdnVPDGKDYQHAIYPILFLLLVFTGLWLYCLHAA 313
156085771 309 RPLCKY---YNPDVITFGIFTLLFLLLVSTLIALGAKYHTNIASIAADIKCGTLIAMFLYGFVVFVIMLVFGFKGNAIKV 385
156089811 308 RPLCRY---YNPDVITFGIFALLFLLLVSTLIALGAKHHQHISAIKAELQSIAPIAIFVYGFVAFVIMLVFGFKGNAIKV 384
156087473 307 RPLCKY---YNPDVITFGIFALLFLLLVSTLIALGAKHHGHISGMAGDLKNIAPIAIFVYGFVVFVVMLIFGFKGNAMKV 383
156087444 315 KPFGQYhtvWEVGSFMLGLFLLAMVVIAGVVIVAAAANKSWSIGTVNMFTGFHSLAIPAYFLVVLALFIFYGRKSGLLKR 394
156087446 307 RPLCKY---YNPDVITFGIFALLFLLLVSTLIALGAVHHQHISGMAGDLKNIAPIAIFVYGFVIFVIMLVFGFKGNAIKV 383
156085769 313 KPFGQYhtvWEVGCFMLGLFLLAMIVIAAVVMGVAAFAKGN-PAVPKMFEGWHSLAIPAYFLVILVLFIIYGRKSGLLKR 391
156082612 309 RPLCKY---YNPDVITFGIFTLLFVLLVSTLIALGAVHHGHIKAIAFELKSIAPIAIFVYGFVVFVMMLVFGFKGNAIKV 385
156084106 308 RPLCRY---YNPDVVTFGIFALLFLLLVSTLIALGVMHQKIISGIAADAKTIAPIAIFVYGFVVFVVMLIFGFKGNAMKV 384
156083389 307 RPLCRY---YNPDVITFGIFALLFLLLVSTLVALGALYHSSMAAIAGEMKPIASIAIFVYGFVVFVVMLIFGFKGNAIKV 383
156083391 314 KPFGQYhtvWEVGCFMLGLFLLAMIVIAGVVMVAAAGNNQWNIQGIKIFEGFHSLAIPAYFLIVLVLFIIYGRKSGLLKR 393
156085771 386 IKGLIKQARDERFLSNAHELDANPLYNSDSETPGSECNLRGPESSGGVFRDSWLHPTN 443
156089811 385 MKAFAKQVRDQRLLSNARMLDTEDLYDTGVETPGSECNLRGPESSGGVFRDSWLHPTN 442
156087473 384 IKAFMKQARDERLVKNGHELDVKPLYEPGVETPGSECNLRGPESSGGVFRDSWLHPAM 441
156087444 395 MASWFKKAPEHVQAPVAQEPE-----------PSEPCQLRGPESVGGVYHDSRLHPAK 441
156087446 384 MKAFAKQVRDQRLLSKAHELETEALYNSDSETPGTECNLRGPESSGGVFRDSWLHPTN 441
156085769 392 MGSWFKRAPEQVQPPVTPEPE-----------PSEPCQLRGPESVGGVYHDSRLHPAK 438
156082612 386 IKGLIKQTRDERLVKNAHELDIGPLYDPGVETPGSECNLRGPESSGGVFRDSWLHPAM 443
156084106 385 IKAFMKQARDERLVKNGHELDVKPLYEPGVETPGSECNLRGPESSGGVFRDSWLHPAM 442
156083389 384 MKAFAKQVRDQQLLSKARMLEKEALYDTGVETPATECNLRGPESSGGVFRDSWLHPTN 441
156083391 394 MGLWFKKAPETVQPPVTPELE-----------PSEPCQLRGPESVGGVYHDSRLHPAK 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap