Conserved Protein Domain Family
PTZ00357

?
PTZ00357: PTZ00357 
methyltransferase; Provisional
Statistics
?
PSSM-Id: 173550
View PSSM: PTZ00357
Aligned: 3 rows
Threshold Bit Score: 2159.04
Threshold Setting Gi: 154337302
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146086052    1 MHRRIHKNGEVYTLTKHPPSRSSYLRLLLFPQSPGMSLDGGGISNGPEAQATASAMEEDYCLHGRERFQNQWARAGVFSP 80  
157869092    1 MHRRIHKTGEVYTSTKHPPRRSSYLRRLLFPQFPEMSFDGGGISNGPEAQANASAMEEDYCLHGRERFQNQWALAGVFSP 80  
154337302    1 -----------------------------------MSVDGGGISNDPDKQTTVSAMEENYCLHGREQFQNQWARTGVFSP 45  
146086052   81 ASLRVYGITGEPVLMRSIKQARMLSATFGTCFLGRFPRFRSSPSSGDSDAAAVTQKDNASNAAGPSRSGSSYDSLPFSSL 160 
157869092   81 ASLRVYGITGEPVLMRSIKQARMLGATFGTCFLGHFPRCKSPPSSGDNDAAAVAQKGDASSGAGPSRGSSSYDSLPFSSL 160 
154337302   46 ASLRAYGVTGEPVLMRSIKQVRMLGATFGTCFLGRFPQSKLPLSLEDNGPTAVTQR------------GSLYDSLPFSSL 113 
146086052  161 LLGPCPPPNMTADPHMLHQAWRREVAGTWSALHMPSEWCQTMNGVATELSWSTRAQRKRIAEQLELAAFMCLRAVQVPLP 240 
157869092  161 LLGPCPPPNMTADPHMLDQAWRREVAGTWNALHMPSEWCQTMNGVVTELSWSTRAQRQRIAEQLELAAFMCLRAVQVPLP 240 
154337302  114 LLGPCPPSNMMADPRMLDQAWSREVAGTWSALHMPSEWCQTMNGVVTEISWSTRAQRQRIAEQLELAAFMCLRAVQVPLP 193 
146086052  241 FYAADVAWSGGDDDDSRDQEDNEGGATAGKRGGAQPMSDEEENQRNIRVACLAADVVLSFIQQCTRVKVWVRCDACNPAH 320 
157869092  241 FYAADVAWSGGNDDDGRDREDNEGGATAGTRGGAQPMSDAEENQRNIRVACLAADVLLSFIQQCTRVKVWVRCDACNPAH 320 
154337302  194 FYATDTPWSC--DDDSSDEKDKDGGTTMGTRGSTQTISAEEANQRNVRAACLAADVVLSFIQQCPRVKVWVRCDACNPAH 271 
146086052  321 RYQLQRLRQAVLYGYSTLKTDSGRVIYRINTPCSVTSTTTSLMSDASPPSSSSSPRSGVVHTEAASSLMALLYYSTWNPR 400 
157869092  321 RYQLQRLRQAILYGYSTLKTDSRRVIYRINTPCSVTSITTSLMCGAPPPSSSSSPRLGVVHTEAASSLMALLYYSTWNPR 400 
154337302  272 RYQLQRLRQAVLYGYSTHRKDTEQLMYRINTPCSVTNMATSFMSDALP--SSSSPCCRVVHTEAAASLMALLYYSTWNPR 349 
146086052  401 MLLPSEWFGEEVVGFECPTAPALLACLAPHGVAPHEHPNYRPDAPGTassthhrpsaTLAEEDVVEAQEQAHPNHGNPDE 480 
157869092  401 MLLPSEWFGEEVVGFECPTAAALLACLAPHGVAPPEHPHYRPDAPGT----------TLAEEDVVEAQKHEHPNHGDPDE 470 
154337302  350 MLLPSEWFGEDVVGFECPTASALLACLAPHGVAPQEHPHYRLST-------------TLAEKDAEEAQEYEYQNNAYHDE 416 
146086052  481 DNAPLRRTPPTYHDGESEGSRTGYSLFDWYDSVTELETSHEADSAVAAAKGGSKGSGSASDTSYEAAADCRRSHLLRSRY 560 
157869092  471 DSAPLRRTPPTYHKGESEGSQADYSLFDWYDSVTELETSHEAGSAVAAAKGGSKGACSASDTSYEAAADCRRSHVLRSRY 550 
154337302  417 DGAPLQRTPPACLDGESEASQADYSLGDGYDSVTEHEASHPADSGAVAANGSP---GSAPASFSEKAADCRRSEVLQHRY 493 
146086052  561 TYVMPEDLQPLVASRWAGTYPPFVSAITFIVELLRRRAMPVFDRTFFDQYPLLNYLHFKGVEEPTRDVFASFEGQLQLPL 640 
157869092  551 TYVMPEDLQPLVASRWAGTYPPFVSTLTFIVELLRRRAMPVFDRTFFDQYPLLNYLHFKGVEEPTRDVFASFEGQLQLPL 630 
154337302  494 TYVMPEDLQPTVASRWAGTYPPFVSALTFIVELLRRRVMPVFDRTFFDQYALLNYLHFKAVEEPTRDVFASFEGQLQLPL 573 
146086052  641 QPLSHHLSSGVYEVFERDARKYRQYREAVFHYVRDWYAAGAEQQHAHQNKMFFAKHGAMQRVPVPSPDERTLHLVLLGCG 720 
157869092  631 QPLSHHLSSGVYEVFERDARKYRQYREAVFHYVRDWYAAGAEQQHAHQNHIFFAKHGVMQRVPVPSPDERILHLVLLGCG 710 
154337302  574 QPLSQHLSSGVYEVFERDAQKYRQYREAVFHYVRDWYAAGVEQQHAQQNSEFFAKHGVMKRVPVPSADERTLHLVLLGCG 653 
146086052  721 RGPLIDECLHAVSALGVRLRIFAIEKNPPAAAFTRMRWANDPEWMQLAYTFGHTLEVIVADGRTIATAAEDGSLTLPADF 800 
157869092  711 RGPLIDECLHAVSALGVRLRIFAIEKNRLAAAFTRMRWANDPEWTQLAYTFGHTLEVIVADGRTIATAAENGSLTLPADF 790 
154337302  654 RGPLIDECLNAVSALGVRLRIFAIEKNLPAASFTRMRWANDPEWTQLAYTFGHTLEVIVADGRAIATAEENNSLTLPADF 733 
146086052  801 GLCDLIVSELLGSLGDNELSPECLEAFHAQLEDIQLSRGIAFNPHLMCIPQQYTAWVAPLMSATFDAAVTEAAVKGLTVP 880 
157869092  791 GLCDLIVSELLGSLGDNELSPECLEAFHAQLEDIQLSRGIAFNPHLMCIPQQYTAWVAPLMSATFDAAVTEAAVKGLTVP 870 
154337302  734 GLCDLIVSELLGSLGDNELSPECLEAFHAQLKDIQHRRGIAFNPYLTCIPQQYTAWVAPLMSASFDAAVMEAAARGLTVP 813 
146086052  881 PPGCHDRHAALNHTLLVTNLSRAVTLAPPQPCWTFEHRFHGGSGNDYKGDRGAMKRREPVSLERAASLVFQVPPCGRCCG 960 
157869092  871 PPGCHDHHAALNHTLLVTNLSRAVTLAPPQPCWTFEHRFHGGSSNYYKGDRGAMKRREPASLERAASLLFEVPPCGRCCG 950 
154337302  814 PPGCSDHHAALHHTLLVTNLSRAVTLAPPQPCWTFEHRFSSSYDD--KRDYGTMKQQVPVLLERSASLLFEVPPRGRCSG 891 
146086052  961 LAGYFSAVLYESATAPATIIATAPVERTEDMYSWFPCVFALEPAQQAELQDVGQAAAEESRMVAIRVQLDRRTGLAEQRV 1040
157869092  951 LAGYFSAVLYQSATAPATIIATAPVERTEDMYSWFPCVFALEPAQQAELQDVEQAAAEESRMVAIRVQLDRRTSLEEQRV 1030
154337302  892 LAGYFSAVLYQSATAPATIIATTPAQRTEDMYSWFPCVFALEPAQQMELHEVGQASAEQKPMVAVRVQLDRRASLAERKV 971 
146086052 1041 WYEWSVTYGDAAVERQSPRTGRDASAAPLVHNKNGWAASMLL 1082
157869092 1031 WYEWSVTYGDAAVERQSPKTSGDASAAPLVHNKNGWAASMLL 1072
154337302  972 WYEWSVTYGDVAAAQKSPSASHGAAAAPVVHNKNGWAASMRL 1013
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap