Conserved Protein Domain Family
PTZ00355

?
PTZ00355: PTZ00355 
Rhoptry-associated protein 2; Provisional
Statistics
?
PSSM-Id: 173548
View PSSM: PTZ00355
Aligned: 4 rows
Threshold Bit Score: 626.107
Threshold Setting Gi: 124505955
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156094280   1 MKAIILISFLVTLFFNNGVDGHTCTKELYNMNFKDLSITSMVLEHSTTRKILGNWVHFFFSHFSNPTDAIKYVEDINLYA 80 
124505953   2 IRKFLISLFLIFLCLNNVVIGNKCKKALIDIDTKDLSLSSILRAHKPDNTTLGSWVYFFFNHFSNVDEAIEYLKGLNINV 81 
124505955   2 GLKFYVLVFLI-LCLKNVVKGDKCETEFSKLYPESNSLTGLIYAHTANVHKLSMWVYFIYNHFSSADELIKYLEKTNINT 80 
221057337   1 MKVIILISFLVMLFFNNGVDGYNCTKELYNMNLRDLSITSVVLDHRTSRKELGAWVHFFFSHFPTPADAIKYVEDINIYA 80 
156094280  81 LDNKDQTCFVRAFTIYLIQNYAKDIKSMSNTDNYETYFKNLLKDVHPDFSKDFLSLFTSATLLGYIDGLVLKEQDISNLK 160
124505953  82 LDIEDHACFARAFSVYLLHFYAKDLKMMIRNEEHESFFKNKLSEINNIISGDFLSTLKHEYFFDKLPSIIVKEKDASHIV 161
124505955  81 LENSDHTCFARAVTLYLFYYYLKDIKSMLSTDDYQSFFKNKFKDINPLFINDFILILNDKKFMENLDLYIMKESEREHLV 160
221057337  81 LDNEDQSCFVRAFTIYLIQNYAKDIKSMSNTDNYETFFKNLLKDVHADISNDFLSIFSSPTLLGYIDNLVLKEQDVNNLK 160
156094280 161 NDVNIFKKHISKADRRTHATYNTNPIPAFAPYDIRtFRRSYLPKEDPSISVSEVYAARDINFLAFLGVSDMYYNSDITQP 240
124505953 162 KRTDFLQDILEKADLNNHAIYKNDPTKVFIFNEIN-FFRTFQLEGKPHIPDDQLSFMRDYALLIYLGTKENYYNSDITEY 240
124505955 161 IKKNPFLRVLNKASTTTHATYKSNPY-FIVGSRVHtPYKDYLGDFNKYTEISVLNYVRDYNFLIYAGSRENYYNSDIAGP 239
221057337 161 NDVNIFRKTISKADRKTHATYTSNPILSFSQYDIRrFRSAYLVKEDPSINMSEVYAARDINFLAFLGVSDMYYNSDITQP 240
156094280 241 ARGTSIIISKRKRLGLKRRSSSLLLLGPHNHNPTFGFCVKDGKEDYFGSVDDLLPSFFSVMKTKMIYGHKRFLREFDYSL 320
124505953 241 AQGNYNISKNRTRLGLKKRSKTFSLDDPQKNSNIFAFCEKNGKEEFFGTPDDLISSFFSDMKAKMVKGHKRFLMEFDYAV 320
124505955 240 ARSVNNVISKNKTLGLRKRSSSLALVGTNNNDPIFAYCEKDNKSEYYGTPDDLITSFFSIIKTKMLNSHKTFLRQFDYAL 319
221057337 241 ARGTSIVINKRKRLGLKKRSTSLVLLGPHNHNPTFGFCEKDGNEDYFGYVDDLLPSFFSVIKTKMIYGHKRFLREFDYSL 320
156094280 321 MHKTYKMPNLKGLRLLKSFFRRKNLENFVDMYSNLMSTELDFLTEDFAELFDITMNCHMREHFDRAIVNFHMIKEKGMES 400
124505953 321 KNRTYALPKVKGFRFLKQLFQRKNLKNFVGMYINLLSTEIDFLAEDFVEMFDTTMNCYGRQHAARAADHYMDMKLSNIFK 400
124505955 320 FHKTYSIPNLKGFRFLKHLFQKKNLVNFVGMYENHVSTEINFLAEDFVELFDVTMDCYSRQYSNRAAENFKAIRELNVL- 398
221057337 321 IHKTYKMPNLKGFRFLKSLFRRKNLENFVDMYSGLMSTELDFLAEDFAELFDITMNCNMRDHFDRAIVNYHMIKEKGMES 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap