Conserved Protein Domain Family
PTZ00354

?
PTZ00354: PTZ00354 
alcohol dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173547
View PSSM: PTZ00354
Aligned: 14 rows
Threshold Bit Score: 460.652
Threshold Setting Gi: 167516840
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154337886   1 MMRAVVLKGFGGADMMTLGEVPKAAVKKgTDVLIKVMAAGVNRAGVSQWRDRYELPDGANSLLGLEVAGIVEQVGSDvVG 80 
154341002   3 MMRAVTLKGFGDTDMLQISCIPKAAITRgRDILIKVSAAGVNRADAAQRHGHYLPPKGSSEVMGLEVSGVVEQVGVD-VK 81 
146093035   3 LMRAVTLKGFGDTDMLQISRIPKAAITRgRDILIKVSAAGVNRADAAQRKGHYPPPKGSSEVLGLEVSGIVEQVGDD-VK 81 
146161225   1 -MKHIYQDQPGDVNVLKIKESPLPQLKQ-DEVLMKISYTAINRAEVLQRQGKVYPSPGHSPIIGLEASGYVVD------- 71 
145513638   1 -MKHVTQTEYGGPQVLKLGESEIPKPLE-NQSLVEIKSTSINRADTLQRQGLYSMPKGVTPILGLEFAGYELD------- 71 
145535734   7 TTQKVNQTEFGGPNVLKLGESLIPKPNQ-NQSLIEIHSTSINRADTLQRQGKYPPPKGVTNILGLEFAGYELD------- 78 
73536692    3 LMRAVTLKGFGDTDMLQISRIPKAVITRgRDILIKVSAAGVNRADAAQRKGHYLPPKGSSEVLGLEVSGIVEEVGVD-VK 81 
72387329    3 TMRAVTLKAYGAVNMLGIGQVPEPAFSRpNDVLIKVVAAGVNRADISQRRGHYPPPPGVSELLGLEVSGVVLRVGSN-VK 81 
118376712   1 -MRHVHCSGFGGVDVLNFKTSPIPALKK-DEVLIKVQATALNRADTLQRQGKYPPPPGASDIIGLEAAGYLLD------- 71 
71420395    3 SMRAVTMRAFGDVDVMHISEVTGVSLSRpSDVIIRVMAAGVNRADVSQRQGHYPPPKGSSEILGMEVSGVVEKVGEN-VK 81 
154337886  81 RVKEGDRV---MALLPGGGYADYAVAHMGCVMAMPQGYTFTEAAAIPEAFITAWQILNRHGKVKARQRVLIHAGASCIGS 157
154341002  82 DFKEGDKV---MALLRGGGYAEYAVAHEGSVMHIPRGYSFIEAAAIPEAFLTAWQALKYHGHCRKGHHVLIHAGASGVGT 158
146093035  82 DFKEGDKV---MALLPGGGYAEYAVAHEGSVMHIPQGYSFIEAAAIPEAFLTAWQALKYHGDCRRGQKVLIHAGASGVGT 158
146161225  72 --HLGKELypaIGLFSGGTYAQYAAIHKNHVFELPKGLTLEQGAAIPEAWITAYQLIKYIGQVQKNDYVMIYAAASGVGT 149
145513638  72 --ENGNRTrkvMSILPGGGYSQFAVVNKDHLIDVPANIPLEIAGGISEVYLTAY-LLYKLSDLRKGDSCLIYAAASGVGQ 148
145535734  79 --TEGNRLrrvMGILSGGGYAQYVAVNKDHLIDVPSNIPLDAAGGISEIYLTAY-LQYKLSELKKGNSCLVYAAASGVGQ 155
73536692   82 DFKEGDKV---MALLPGGGYAEYAVAHEGSVMHIPQGYSFIEAAAIPEAFLTAWQALKYHGDCCKGQKVLIHAGASGVGT 158
72387329   82 RFGEGDRV---MALLAGGGYADLVVAHEGSVMKIPDEYSFVEAAAIPEGFLTAWQLLRRHGSLKKGQCVLVHAGASGVGT 158
118376712  72 --QNGKRV---VALLSGGGYSEYVAVNKDHILEIPDQMSFSDAAGLAETWLTAYQLLKKVGCSKPGENVLIYAGASGVGT 146
71420395   82 RFKEGDRV---MALLTGGGYAEMAVAHEGSVMKIPEGYSFVEAAAIPEAFLTAWQALKLHGNLQKGQHMLFHAGASGVGT 158
154337886 158 ASAQITEKYFRATAITTSPEEKLGECKAYASVALSHARDELGwaFAPKVKCLFGEESVNVIVDSVfGGTYLTENAQVLAP 237
154341002 159 AAAQIVEKHFQAIAVTTSSELKVEVCKNFASINLARTPDETGmcFSPKVRNLLGEGAINLVLDSVfGGSYISEDAAVLAK 238
146093035 159 AAAQLVEKYFQATALTTSSESKVEVCKNFASINLTRTPDETGmcFSPKVKSLLGEGAINLVLDSVfGGSYISEDAAVLAK 238
146161225 150 AAIQLAKYFGAHAIASSSSEDKLKICKELGAELCINYKTCEN--QDEEILKFTNGKGVNLVLDCV-GAQNFKLTDKIIGV 226
145513638 149 AALQLGNIFGVNTI-ASCSKGKVDAIKKYTKNIIIRDDTIEE---QFKQLQNICPQGVNAVFDCI-GKQNYKLTVDSLAI 223
145535734 156 ATLQLCNHFGVIGI-ASCSQLKVQKIQQYTNYIVHRDQSIKD---QISQIKQYQPQGVAAVFDCV-GQQNYQMTLETLGM 230
73536692  159 AAAQLVEKYFQATALTTSSESKVEVCKNFASINFTRTPDETGmcFSPKVKRLLGEGAINLVLDSVfGGSYISEDAAVLAK 238
72387329  159 SLMQLAGKYFGAKVVATCSEGKVDFCKKFADIVVDRSPDEMGrcFCHKVKSAVGDDAVNLVVDPVvGGSYLNEDGIVLAQ 238
118376712 147 AAIQLCSLFNTNAIVSVSSPEKLQFCKNLGAQGGIIYKDNLK--QKEQILELTKRKGADIVLDCI-GASNVDLTLSVLNY 223
71420395  159 AALQLAEKYFRATAIATCSSGKVEFCKRFAKFVVDRSPDASGkcFSSKVRDAVKGETVNLIVDPVvGGTYLQEDGEVLAQ 238
154337886 238 NGHLIVIAFMGGALVR-VNALPLFREKAQITFSKLHCRSDQYKMELVTSFEREIVPYMSERIISTIVSRTFP-------- 308
154341002 239 DGRIIVLAFMGGAKVH-LNCLPLLRQRAHIIFSKLRCQSDDYKENLVCTFEKEVLPYINERVIVPVANKTYP-------- 309
146093035 239 DGRIVVLAFMGGATVH-LNCLPLLRQRAHVMFSKLRCQSDDYKQNLVDTFEEAVIPYMNERLIVPVANKTYP-------- 309
146161225 227 DGKWILYGSLGGTNIEkFDLGSLMRRRASLITTLLKTRSDEYKSDLISNFKKDTIEGFCSGQLKPIIDRVINitwd---- 302
145513638 224 DGKWILYGLITGGLVEnFNLASLLHKRISLINTTLRSRPDEFKKNLIEEFNQNVLPYIANGAIDIPVDSITKikwd---- 299
145535734 231 DGKWILYGLLTGGSIEkFNLAPLLAKRINLINSTLRSRSDQFKAELAKDFTRTILPVIENGQIAIPIQSVTKvqwn---- 306
73536692  239 DGRIVVLAFMGGATVH-LNCLPLLRQRAHVMFSKLRCQSDDYKQNLVDTFEEAVIPYMNERLIVPVANKTYP-------- 309
72387329  239 DGKIVVIALMGGSKVE-LNISTLLRKRGTIVFSKLRDQTDEYKASLVEEFEREVIPYLKDRIITPIVQRTFA-------- 309
118376712 224 DARWVLYGLMGGAKVPnFNLASLVGKRGSLICSTLRSRTDCYKRDLVRDFQFQAMPLFRNNTFKTIIDKVYNvnlnddkd 303
71420395  239 DGKVVLLAFMGGAKVS-LDVMPFFRKRASVIFSKLRDQTDEYKEALVRSFEEEVIPYMTRREIVPVVQCTYA-------- 309
154337886 309 -------------------------------LEEAASAHKFVEENGDY----------GKVVLTVCEPSKA 338
154341002 310 -------------------------------LEEVAQAHARLDDSRAW----------GKIVLTFSNSLTT 339
146093035 310 -------------------------------LEEVAQAHARLDDRKAW----------GKIVLTFNSHLSA 339
146161225 303 ----------------------------eegLKGWRDAHTTMESNENI----------GKIVVAYPKI--- 332
145513638 300 ----------------------------qngINEFIRLHTEMEQNKSA----------GKQIVAFE----- 327
145535734 307 ----------------------------eegINQIIRLHTEMEQNRNV----------GKLIVSFQND--- 336
73536692  310 -------------------------------LEEVAQAHMRLDDSKAW----------GKIVLTFNSHLSA 339
72387329  310 -------------------------------MEDVAEAHVFMEGNMTN----------GKVILTMCDSTGE 339
118376712 304 vekiciqiklfdcqtqqknffkstqmliiviLDGFSTPYGKLSQSVNIyqifwikifmVEILINYNEFKYL 374
71420395  310 -------------------------------LEEVAAAHKLMENNKSN----------GKVILTVGKAE-- 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap