Conserved Protein Domain Family
PTZ00353

?
PTZ00353: PTZ00353 
glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173546
View PSSM: PTZ00353
Aligned: 6 rows
Threshold Bit Score: 548.322
Threshold Setting Gi: 146102097
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72549722    1 MSITVGINGFGPVGKSALFAALADPLFTVTAVVDVSVCAAYIAYVIEQEYPHRNPTGPPIRVTDkqkDQIVLNNTHVIHV 80 
71659658    6 LPVCVGINGFGPIGQAVLFSSFTDPLVSVVAINDASMSIDYIAYLLRRESSLSAGDRASVLVVG---EFICIQGSQKIRV 82 
71407160   30 LPVCVGINGFGPIGQAVLFSSFTDPLVSVVAINDASMSIDYIAYLLRRESSLSAGDRASVLVVG---EFICIQGSQKIRV 106
71745304   13 LPIPIGINGFGAVGRAVLFASMTEPQVTVVAVNDFSVSINYVLYVLQNESPLSAEDKASLTVVG---EYIFYRGTERIRV 89 
146102097   1 MSITVGINGFGPIGKSALFAALADPLFTVTAVVDASVCAAYIAYVIEQEYPHRNPTGPPIRVTDkqkDQIVLNDIHAIHV 80 
154345255   1 MSITIGINGFGPVGKSALFAALADPSFTVTAVVDASVCAAYIAYVIEQEYPRRNPAGTPIRVTDtrkDQIVLNDTQVIYV 80 
72549722   81 SAAQDPQSSMWKKYGAQYVLECTGLYTTRSRSWGHVTGGAVGVFIAAASADTNTVMASSGLERLAASLPVCAAGAPIGAV 160
71659658   83 SHKHDLVEIAWRDVGVQYVVECTGLSSTRERCWGHVAGGAKGVIVAGQSADAPTLISGANDEELKSACSVVCAGSPVAVA 162
71407160  107 SHKHDLVEIAWRDVGVQYVVECTGLSSTRERCWGHVAGGAKGVIVAGQSADAPTLIAGANDEELKSACSVVCAGSPVAVA 186
71745304   90 TQKHDLVDIAWRDAGVSYVVECTGFTSTRDRCWGHLTSGARGVLVAGQSGDAPAIVAGVNDSDLSKIQPIICSGAPLAVA 169
146102097  81 SAAQDPQSSTWKKYGVQYVLECTGLYTTRSRSWGHVTGGAVGVFIAAASADTNTVMASSGLERLAASLPVCAVGAPIGAV 160
154345255  81 SAAQDPQLSLWKQYGARYVLECTGLYTTRSRSWGHVTGGAAGVFIAAASADINTVMASSALERLSASLPVCAAGTPIGAA 160
72549722  161 VAPVLDALAKVLEIEQVSYTALYGPQPQHPIGAKSDDSRDWRQVRLqpfASCAMASSRDNGAETVGALLPHLVGRVSASA 240
71659658  163 LAPLIRLLHEQYGLEECSYTAIHGMRPMELTAGRSKNPQDWRQTRV---SIDNIVPYIDNGKKTMDKILPGLVGRISGTA 239
71407160  187 LAPLIRLLHEQYGLEECSYTAIHGMRPVELTAGRSKNPQDWRQTRV---SIDNIVPYIDNGKKTMDKIFPGLVGRISGTA 263
71745304  170 LAPFIRILHESFGVEDCSYTAIHAIQPVEPNAARSANSQDWRQTRV---TLDSITPYAHTGMTTFCKLMPTLSSRITGSA 246
146102097 161 VAPVLDALAKVLEIEQVSYTALYGPQPQHPIGAKSDDSRDWRQVRLqpfASCAMASSRDNGAETVGALLPHLAGHVSASA 240
154345255 161 VAPVLDALAKVMEVERVNYTALYGTQPQHPIGAKSEDSRDWRQARLqsyANCAMASSRDNGAETVCALLPHLAGHVSAGA 240
72549722  241 FQVPVAQGCAIDLVVYTKEAASADVVASAFAPAAADSEPLVkVCIANGPMISVDCIGSSSVILDATSLSSSTEGKVHRMV 320
71659658  240 FQVPVKKGCAVDMLVRLSQPVSKEMLDQALKEAASGRLNGV-LSYSKEDLISCDCVPNGKLCYDATGSYSLRDGEAQKLL 318
71407160  264 FQVPVKKGCAVDMLVRLSQPVSKEMLDQALKEAASGRLNGV-LSYSKEDLISCDCVPNGKLCYDATGSCSLRDGEAQKLL 342
71745304  247 FQVPVTKGCAIDMLLRFKQPVAKESVDEALIEASKDRLKDV-LFVSKRDFISRDLLPDGKLCYDPSASQCVREGELYKFT 325
146102097 241 FQVPVAQGCAIDLVVYTKEAAPADVVASAFAHAAAGSKPLSkVCIANGPMISVDCIGSSSVILDAASLSSSTEGKVHRMV 320
154345255 241 FQVPVLQGCAIDLVVYTKEAMSADVVASAFAHSMVDSESTAsVCIANRPMISVDCIGNSRVMLDVASSSSSTDGKVHRMV 320
72549722  321 LWVDVACYYAALLLSLAKQVHSIHAPPSS 349
71659658  319 LWFDIDGGYARRLLSLVVLLHQMGPSDGM 347
71407160  343 LWFDIDGGYAKRLLSLVVLLHQMGPSDGM 371
71745304  326 LWFDLERSFAKRLISLIPVMNDADAKKNN 354
146102097 321 LWVDVACYYAALLLSLVKQAHSIHAPPSS 349
154345255 321 LWVDVECYYAAVLLSLVKQVHAIHTPPGP 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap